PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012572672.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family HB-other
Protein Properties Length: 1766aa    MW: 199578 Da    PI: 6.0178
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012572672.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.52e-172175357
                    --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                    kR   t++qle+Le++++ ++yps+e r eL  klgL++rq ++WF+ rR k++k
  XP_012572672.1 21 KRKMKTASQLEILEKAYAAEPYPSEEFRVELCVKLGLSDRQLQMWFCHRRLKDRK 75
                    89999************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-17575IPR009057Homeodomain-like
SuperFamilySSF466895.13E-151676IPR009057Homeodomain-like
PROSITE profilePS5007116.4551676IPR001356Homeobox domain
SMARTSM003897.1E-141880IPR001356Homeobox domain
CDDcd000862.09E-122175No hitNo description
PfamPF000464.2E-152175IPR001356Homeobox domain
PROSITE profilePS5082717.031547606IPR018501DDT domain
SMARTSM005712.9E-22547606IPR018501DDT domain
PfamPF027912.6E-16548603IPR018501DDT domain
PfamPF050661.2E-13727794IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156125.0E-9940980IPR028942WHIM1 domain
PfamPF156135.0E-1211221194IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1766 aa     Download sequence    Send to blast
MENCSEVEKK KKPPEEENKV KRKMKTASQL EILEKAYAAE PYPSEEFRVE LCVKLGLSDR  60
QLQMWFCHRR LKDRKAVKTA ASISAPTVEG VEQIEIADVR HDHGLVSVLK LIDHDDLRRV  120
VPQHGMMAYP RMGAGLHAMD SSSSFHEPQL TILELRAIAF VERQLGEALR EDGPILGMEF  180
DSLPPGAFGA PLGVVSIGQH RESELPVEAK VYEHLNKGVS RTLHEYQFIP EQPTVRNEMY  240
ARVTTSIHFS SLDGVPHSGT TLSSGQSFLN GNEFAPNVYG VQGQKIPSLN LLSQSQQGRP  300
NNLMFSASGG NDDVPRKNPF VDVTLDTHRV ADQVTPIDSP LVPSDRRVIH EEELSRFQRK  360
RKNEEARMQR EFEAQEKRIR KELVKQDILR QKREEQIKKE MERQERERKK EEERLLRERQ  420
REEERFLREQ RREQEQREKF LQKESIRVER LRQKEELRRE KEAARIKASS ERAIARRMAK  480
ESIDLIEDEH LELMELAASK KGLSSILALD YETMQNLESY GDGRTSFPPK SVRLKKAFSI  540
QPWSDSDENV GNLLMVWRFL ITFADVLGIW PFTLDELLQA FHDYDPRILG EIHIALLRSI  600
LKDIEDVART PTTGLGANQN NITNSGGGHP QVVEGAYVWG FDIRNWQWHL NPLTWPEILR  660
QFALSAGFGP LMKKQNIEQV HPCNEGNDGK DIISNLRSGA AVENAVAIMQ EKGLPNRRTY  720
RPRLTPGTVK YAAFHVLSLE GSRGLNILEL ADKIQKSGLR DLTTSKAPEA SIASALSRDT  780
KLFERTAPST YCVRPAYRKD PADSEAIYSA AREKIRVFKS GFVGAEEADD GERDENSESD  840
MAENHEIDDL GAETNTKKEV SNSEKFNANT VMRNGKDNGE GFQTPDSCHE KVDEGLASTV  900
DEGFNKHKDV HTSSEIAVCS HDVTNPILEG MDVDENTLGE PWAQGLMEGE YSDLSVEERL  960
HALVALINVA IEGNSIRLIL EERLEAANTL KKQIWAEAQL DKRRIKDDCF VKLQSFSYLG  1020
NKNEPAVTFP SVEGKQCPLH TVHVKIDKAS VTPYDQHEQI NALQGNQNHL QSSLLDVNIQ  1080
RQDCPTGPDN CSLQQSGYVA EKSRSNFKSY IGHLAEQTYM YRSLPLGLDR RRNRYWQFIT  1140
SASQNDPGCG RIFVELHDGC WKLIDSEEGF DALLASLDLR GIRESHLHMM LQRIEMSYKN  1200
SVRRNVQNGD MGIQNGDTMK KLKTETVKMG TDQDCSATSV YVDDLDTSVT STSFMVQLGR  1260
NEVENKDAYM RYWDFEKWMQ KQCLNCSVSF AMKFGKKRCN QLLLMCDLCH RVYFSRGTPS  1320
PCPSCHRTST SQDNSSSYEC IARSEGKRKI GTHLFNHPSS SPFRMRLLKI LLSVVEVTLP  1380
QEALQPFWTE RYRKSWSSKL EASSSPEDIL QTLTALEGAI KREYLAPDYE TTSELLGTVC  1440
SSGCLPNDTI GGGQIPVLPW VPYTTAAVAL RLMELDACIF YTSQQKLESE KDKKNGVVIK  1500
LPSKYAAAKN SYNASVIETS FQAKHAVENL GALGAGLESY SRGQRTRLGR GHSHGQRSQG  1560
RVSSSRPTSR KRSTTSNNRK IGKLLGWKGR PNGQGQFCGR RSIRSWQKPA AKTDVLNSKR  1620
DTRNVIKEKT PIFVREEINE SKTEASALNA RNSETSDNEE DLYQATGDEY DYLVGNNNNG  1680
GYQGGFCGKS DNLIEQSHYI LDDEEDGDMD NDDNVNDDKE DGQVDLNVED YIIGEDSKDA  1740
GYNREIIAEQ NEEPDGVFST SSDYID
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator required for the maintenance of the plant vegetative phase. In association with CHR11 or CHR17 may prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing, such as FT, SEP1, SEP3, AGL8/FUL, SOC1 and FLC (PubMed:22694359). Involved in the transcriptional regulation of seed-specific gene expression (PubMed:23872538). {ECO:0000269|PubMed:22694359, ECO:0000269|PubMed:23872538}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_012572672.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1515270.0AC151527.13 Medicago truncatula clone mth2-135i19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012572672.10.0homeobox-DDT domain protein RLT2 isoform X3
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLA0A1S3EA180.0A0A1S3EA18_CICAR; homeobox-DDT domain protein RLT2 isoform X3
STRINGXP_004505537.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25233369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator