PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012572567.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family HB-other
Protein Properties Length: 1772aa    MW: 199604 Da    PI: 4.942
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012572567.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.72e-1847102257
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                      kR+  t+ qle+Le++++ ++yps+  r eL++klgLt+rq ++WF+ rR k+kk
  XP_012572567.1  47 PKRQMKTPFQLETLEKAYALDNYPSEPVRVELSEKLGLTDRQLQMWFCHRRLKDKK 102
                     69****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.0E-1829103IPR009057Homeodomain-like
SuperFamilySSF466892.44E-1733103IPR009057Homeodomain-like
PROSITE profilePS5007116.87643103IPR001356Homeobox domain
SMARTSM003893.6E-1945107IPR001356Homeobox domain
PfamPF000465.0E-1647102IPR001356Homeobox domain
CDDcd000861.45E-1448104No hitNo description
PROSITE profilePS5082717.048557616IPR018501DDT domain
SMARTSM005711.5E-22557616IPR018501DDT domain
PfamPF027911.6E-17558613IPR018501DDT domain
PfamPF050666.5E-15743811IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156124.3E-8946990IPR028942WHIM1 domain
PfamPF156132.9E-1411231195IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1772 aa     Download sequence    Send to blast
MEGEAGSEGD SDRKRGGADD NSDENNNNNN DVSNSKIAIS NEGQSKPKRQ MKTPFQLETL  60
EKAYALDNYP SEPVRVELSE KLGLTDRQLQ MWFCHRRLKD KKESAPKKPT RKPVPEPLPD  120
SPVDDLRLGS EHGNEYGSDS GSGSSPYTHM EPRNAMPQSV GYYESPEVEM ELRAIACVED  180
QLGEPLREDG PILGIEFDTL PPDAFGAPIA VTEHQKRPGL SYDSKTYGRH DIRTNKAMAR  240
TSDEYKFLPN QSGIRSDSFG QFSQSHSLSM EGPSRSPQFV LGHERLPKIH ANHGHSSRVS  300
LLSQQDRQGS PYQSPSRDDN VSSPRELYPN TVKVEMNSYL TDCQTVGPEN PKALTSGQFL  360
QNNAMHIDKK RKGDDVKNTR DVEAHEMRIR KELERQDILR RKNEERIKKE MERQDRERRK  420
EEERLMRERQ REEERTKREE KREIERREKY LLKENLKAEK LRQREELRKE KEAERRKAAL  480
EKATARRIAK ESMELIEDEQ LEMMELAASS KGLSSIIRLD FDTLQNIESF RGSLCLFPPE  540
SVKLRKPFAI QPWINSEENV GNLLMVWRFL ITFADVLELW PFTLDEFVQA FHDYDSRLLG  600
EIHVALLKVI IKDIEDVART PCTGLGMNQN GAANSGGGHP EIVEGAYAWG FDIRNWHKHL  660
NQLTWPEIFR QLALSAGYGP QFKKSSITCS RANSKDEGSC EDIISTLRNG SAXXXSAAEN  720
AVAKMQERGL LGPRRSRHRL TPGTVKFAAF HVLSLESGEG LNVLELAEKI QKSGLRDLTT  780
SKTPEASISV ALTRDAKLFE RVAPSTYCVR AAFRKDPADA ESILSEARKK IQIFENGFLA  840
EEDADDVERE ESESEVDEDP EVDDLVNPSS VDKKSEQGND FSSSGKENLG PGGERKDEFN  900
KDLPCFPENG SKNTDCPIAV SGEPVACENL SARNLGDDNM EIDESKSGES WVQGLTEGEY  960
SDLSVEERLN ALAVLVGVAN EGNLIRVVLE DRLEAANALK KQMLAEAQID KARPKDDNVN  1020
KSDFPSINGD KVETQFTYAA VEGNHSPFLG ICNNNNGESP SKTENKSSAL VGQSLSEKLS  1080
SVQDLCIGPD NHQTLLSAQY SKRSRSQLKS YISHLAEEMY IYRSLPLGQD RRHNRYWQFV  1140
ASASCNDPGS GRIFVEYHDG KWRLIDSEEA FDALLNSLDS RGIRESHLRL MLLKIESSFK  1200
ENVQKNAKCA KIGNTDKTCV KNETDETDSS PDRHTRSDSP SSTLCGLSSD TSETSSSFRI  1260
ELGKSESDKK AALRRYQDFQ KWMWKECYNS SVLCAMKYGK KRCKPQVDIC DTCLNFYCLE  1320
DSHCGYCHRT FPSNDGFNFS KHAIQCGDKL PKNICILESS LPLRTRLLKA LLAFIEVSVP  1380
PEALQSIWSE DIRRLWGVKL SRSSSVEELL QILTLFERAL KRDFILSPFS TTADLLGMNT  1440
MSESATRTSM DLESVTVLPW VPRTTSAVSL RLFEFDTSII YAQLEKPEPC EGKEARYIKL  1500
PSRYASAKPA DLDRDGFMKV NSAPTKIVRS SRKRGRVSHD KGRVRKLSKR TDDCKRDNGR  1560
HNFKVTENLG QRLEQQGQGS QGQAGGSGRR TVRKRRAEKR VVEDLLLGHR AANHSYNIDR  1620
EPLRILDEDW NDEKASPIQM EGADMSDSSE EVEYDDNAQA VESDDNVEAV EYDDHNAQAV  1680
ESDDNVEAVE YGQGNWEIGF NGTPNRWNRD LVGMGDEEDA EVSEDDNGIE ENEVEEEEDS  1740
EADVMSEGSD GMANRVVNEE ISDSSDSEDS SD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
195102RRLKDKKE
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_012572567.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012572567.10.0LOW QUALITY PROTEIN: homeobox-DDT domain protein RLT1-like
TrEMBLA0A1S3E9R50.0A0A1S3E9R5_CICAR; LOW QUALITY PROTEIN: homeobox-DDT domain protein RLT1-like
STRINGGLYMA13G24370.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25233369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.10.0homeobox-1