PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012571682.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family ARR-B
Protein Properties Length: 633aa    MW: 69823.3 Da    PI: 6.5088
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012571682.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.14e-28198251155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr++W+ eLH++Fv+av++L G++kA+Pk+il++m+v+ +t+e+v+SHLQkYRl
  XP_012571682.1 198 KPRVVWSVELHRKFVDAVNRL-GIDKAVPKKILDMMNVENITRENVASHLQKYRL 251
                     79*******************.********************************8 PP

2Response_reg78.22.9e-26141221109
                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTT CS
    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaG 93 
                     vl vdD+p+ + +l+++l++ +y +v++++++ +al++l+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+g+ +++ + ++ G
  XP_012571682.1  14 VLAVDDDPTCLFVLETLLRRCQY-HVTTTSQAIKALAMLRENKdkFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSAYGDTKLVMKGISHG 106
                     799********************.***************888888*******************87754.558********************** PP

                     ESEEEESS--HHHHHH CS
    Response_reg  94 akdflsKpfdpeelvk 109
                     a d+l Kp+ +eel +
  XP_012571682.1 107 ACDYLLKPVRIEELKN 122
                     *************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.6E-1691633IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23002.1E-4311147No hitNo description
SuperFamilySSF521728.97E-3711134IPR011006CheY-like superfamily
SMARTSM004485.5E-3212124IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.49813128IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.9E-2314122IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.08E-2715128No hitNo description
PROSITE profilePS5129410.438195254IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-29195256IPR009057Homeodomain-like
SuperFamilySSF466898.6E-20196255IPR009057Homeodomain-like
TIGRFAMsTIGR015577.3E-25198251IPR006447Myb domain, plants
PfamPF002493.8E-7200250IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 633 aa     Download sequence    Send to blast
MDDPSDRFPI GMRVLAVDDD PTCLFVLETL LRRCQYHVTT TSQAIKALAM LRENKDKFDL  60
VISDVHMPDM DGFKLLELVG LEMDLPVIML SAYGDTKLVM KGISHGACDY LLKPVRIEEL  120
KNIWQHVIRR KKSDPKEKNK TSNRDKTTSD SGGGLRSAGX XXSEENGKLN KKRKDQDEDE  180
DEDKENDHDN EDPSAQKKPR VVWSVELHRK FVDAVNRLGI DKAVPKKILD MMNVENITRE  240
NVASHLQKYR LYLKRISCVA NQQASMVAAF GSADQSYLRM AGSGHFHNNA FRSFSSSGFI  300
SSLNTPAGLN GHGFPPSGIL QLGQSQNLNN SSNDQLKFQS AITPVNQNVL HGTPMSIGFD  360
HSQNSKGVLS VQNLTTDDVK TTFPIPDQRL RLATSSSYPP SLGITNNASS SSGASRHSEF  420
PFSMIDQSRH SDNWSSAVQL SGIQTNSFPS SECFRQTAIP PSDNMASLPL QGAYLSGQSI  480
ASLCSQSHGS LADMHSQGAF FTNPPEYGNS NLPFQGWEDH NQDAIYHSNV TCGSTNSPFS  540
GAVVPSGLTT TNSALHRNLD TRFCDDPIQM KHAGFGELVE CSSSRQPRAN VVSQQKFSNN  600
LGSLEYLVSS TMEQEQDKMK LLNGDLICDN YSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-24194257164ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_012571682.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU0196011e-141CU019601.8 M.truncatula DNA sequence from clone MTH2-12A22 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012571682.10.0two-component response regulator ARR12
SwissprotQ6H8051e-133ORR24_ORYSJ; Two-component response regulator ORR24
TrEMBLA0A1S3E7900.0A0A1S3E790_CICAR; Two-component response regulator
STRINGXP_004501369.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-111response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]