PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012570572.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family SBP
Protein Properties Length: 1017aa    MW: 113664 Da    PI: 7.5303
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012570572.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.45.6e-40111188178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cqv++C++dls+ak+yhrrhkvCe+hska+++l+ +++qrfCqqCsrfh l efDe+krsCrrrLa+hn+rrrk+qa
  XP_012570572.1 111 MCQVDNCKEDLSKAKDYHRRHKVCEAHSKASKALLGNQMQRFCQQCSRFHPLLEFDEGKRSCRRRLAGHNRRRRKTQA 188
                     6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.4E-34105173IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.684109186IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.62E-37110190IPR004333Transcription factor, SBP-box
PfamPF031101.5E-29112185IPR004333Transcription factor, SBP-box
SuperFamilySSF484034.04E-8765910IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.202.4E-5765908IPR020683Ankyrin repeat-containing domain
PROSITE profilePS502978.641803920IPR020683Ankyrin repeat-containing domain
CDDcd002042.70E-5807907No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1017 aa     Download sequence    Send to blast
MEKVAPPPLP LPFHPPMLTN PFYNTSSNNK KRDLSYDVVH IPNDNWNPKE WNWDSVRFIA  60
KSSNTTTTTT TISQDEETLK LNLGGGCGSV NNRANKRVRS GSPSGTPSYP MCQVDNCKED  120
LSKAKDYHRR HKVCEAHSKA SKALLGNQMQ RFCQQCSRFH PLLEFDEGKR SCRRRLAGHN  180
RRRRKTQADE VASPPLNQVA VAANLEIFNL LTAIADGSQG KFEERSQVPD KEQLVQILNR  240
FPLPADLTAK LLDVGNLNAK KDDNVQMQTS SSYHHHDDQP NNAPSAPLTM DLLAVLSTSP  300
SAPAQNGSNT SMTSADQMRE QQFTSVVGER SSGSSQSPND DSDCQEDVRV NLPLQLFSSS  360
PEDESRMKLS SPQKYFSSDS SNPVDERSPS SSPPVVEMNF GLQGGIRSHN RNSISIGIGV  420
NANKETSQSH SCTVPLDLFK GSKSNNMIQQ SSSVQSVPFQ AGYTSSSSDH SPPSLNSDAQ  480
DRTGRIMFKL FDKHPSHFPG TLRTQIYNWL SNRPSDLESY IRPGCVVLSI YATMSSAAWA  540
QLEENFIQRV HSLIHISDSD FWRNGRFLVH SGSQLASHKD GKIRMCKPWG SWRSPELISV  600
SPLAIVSGQE TSMSLKGRNL SAPGTKIHCT GADCYTSSEV IGSQYHGMVY DEIRLGGFKV  660
QNTSPSVLGR CFIEVENGFK GTCFPVIIAD AAICKELRPL ESEFDEEEKT CDAISEDREH  720
NFRRPKSREE ALHFLNELGW LFQRERFSNV HEVTDYSLDR FKFVLTFSVE RNCCMLVKTL  780
LDVLVDKHFE GESLSVVSME MLNAIQPLNR AVKRKYINMV DLLIHYSIPI KNDTTKKYVF  840
PPNLEGPGGI TPLHLAACTS DSEGLVDSLT NDPQEIGLKC WETLVDENGQ TPQAYAMMRN  900
NHSYNKLVAR KLSDRQRSEV SVKIDNEIEH PSLEIELMQK RINQDKRVGN SCSKCAIAEV  960
RYKRRFSGSR SWLHGPFIHS MLAVAAVCVC VCVLFRGTPS VGSVSPFRWE NLDFGTM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-31103185284squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_012570572.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1407740.0AC140774.7 Medicago truncatula clone mth2-5e11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012570572.10.0squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A1S3E4540.0A0A1S3E454_CICAR; squamosa promoter-binding-like protein 14
STRINGXP_004498230.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]