PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012569933.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family GeBP
Protein Properties Length: 399aa    MW: 44922.6 Da    PI: 5.0905
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012569933.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573120.96.7e-3893188197
          DUF573   1 klfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskki 95 
                     k+fqrlw++eDei lLqG++d++a++g  +++d+  fy+ +k++++++++ksqlveK+rrLK+K+++ vkk++sgke++f+++hdq +fe+s+ki
  XP_012569933.1  93 KMFQRLWTDEDEIELLQGFLDYNANRG-TYHNDTASFYDRIKSKLQLEFNKSQLVEKLRRLKRKYRNAVKKIDSGKEVNFKSPHDQATFEISHKI 186
                     58*************************.789**************************************************************** PP

          DUF573  96 Wg 97 
                     W+
  XP_012569933.1 187 WN 188
                     *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.4E-3495188IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MASFQNAVVL FKQEYIEDEL EEEYDEEEDD VVLGEPDEED DNNNKTEPPP STSSAITTVI  60
LALPNAATTV VDGSPEPKRQ HTEEKKSMDD PRKMFQRLWT DEDEIELLQG FLDYNANRGT  120
YHNDTASFYD RIKSKLQLEF NKSQLVEKLR RLKRKYRNAV KKIDSGKEVN FKSPHDQATF  180
EISHKIWNSA APVGNPVEDD DEINPNTNPN PNSGHTTPVK NEPIIEKKTA QSRKRSRTTA  240
STEEKRELNN SPLLNNDNHN YHKHNHNTNN NNSKNHDVVD GGDKCNGRQN VPGLIEETVK  300
SCLTPVLKEL ASSSSAMGSP YGFGGRGFGV GGFSMNTMPL GFLNLGSGEK VVDEKWRKQQ  360
ILELEVYSKR LELVQDEIKV ALDELRSSTG TGVRGVSKF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012569933.10.0probable transcription factor At5g28040
TrEMBLG7I7E71e-129G7I7E7_MEDTR; Transcription regulator
STRINGGLYMA10G30160.21e-105(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32553365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28040.13e-80DNA-binding storekeeper protein-related transcriptional regulator