PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012568344.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family GeBP
Protein Properties Length: 534aa    MW: 59896 Da    PI: 8.4244
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012568344.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573781.5e-24314405397
          DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                      +r++s++Dei++LqGl dfk+ktg++ps +  a+ + +k+s+s+k + +q+ +K+  +K+Kf+kkv++   +k+p ++++hd+k++el+ k+Wg
  XP_012568344.1 314 YNRVFSDKDEIAILQGLADFKSKTGTDPSTNYPALLDSLKDSLSIKPTIKQVRQKVYYIKQKFEKKVNN---DKSPILANPHDEKVYELCCKLWG 405
                     589***************************************************************999...9*********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.4E-22315405IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    Send to blast
MTIANNIKTT IPPTQSAKEY LKFVEDNFFS VNKSLIGTRM AKPTTMKFDG SQDMQEHTIE  60
MANTSKTKVF RSLVFLSKLD NYGFEFNGGH ESSFDPPLTH GGADVTGKQV IRCRTHRILL  120
NDSTLVPPPS TGISSTTTEL TNNPYVIGEV NRMDLIDLDV VYVDHHGGIV VTSIGHECDA  180
HLFDLQRDLR DNMKCLKREK ELERPVEDYN VFIVTHKKST KEFISDRVKN ADPQPSPQTT  240
PIPKKPSSKT LAPPPTKPAS PSSYETESDS HPQIQQPTPP PSNSKSNPSR PARSKKQTPT  300
AAAAAAAADS SNPYNRVFSD KDEIAILQGL ADFKSKTGTD PSTNYPALLD SLKDSLSIKP  360
TIKQVRQKVY YIKQKFEKKV NNDKSPILAN PHDEKVYELC CKLWGHDNEA SEVKEKPRKK  420
ENAAKKPLKL KEPMQIPEQV LSGTEVRLES GKGESSDELS HVSLNLSEMI RFDKMSSDVN  480
VLKRGMELID ESERAEFERR WKKLRVDEMK LFVKRAELVE YQVGLILEAI QGLS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012568344.10.0STOREKEEPER protein-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1816522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25210.11e-11DNA-binding storekeeper protein-related transcriptional regulator