PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012568000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family LBD
Protein Properties Length: 243aa    MW: 26367.5 Da    PI: 5.7403
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012568000.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26039.22e-124475699
          DUF260 56 damsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99
                    ++++sl+yeA+ r+ +P+yG+vg+++++++ql+q+++e++l ++
  XP_012568000.1  4 AIFRSLLYEACGRIVNPIYGSVGLLWSGSWQLCQAAVEAVLKGA 47
                    689***********************************998766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031951.4E-7443IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
LIAAIFRSLL YEACGRIVNP IYGSVGLLWS GSWQLCQAAV EAVLKGAPIT PITSEAAANG  60
RGPPLKAYDI RHVSKEENSA VSNETQQRVK TRSRVKRSNL AKPKLTTDNE EKSSNNKGIE  120
SGSVEPVEEV MNRSASHESS LSHQSEAVNA AAVDGESKES DESMASVETA ETSMNLFRDE  180
PESTRDLKRV DRTGESGEEN VGLELTLGFE PVSRVHHVVP VKKRRVELKD CGGGSWKIEL  240
GLP
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_012568000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012568000.21e-177LOB domain-containing protein 41-like, partial
TrEMBLA0A1S3DX181e-176A0A1S3DX18_CICAR; LOB domain-containing protein 41-like
STRINGXP_004489144.11e-170(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15463499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02550.11e-39LOB domain-containing protein 41