PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004515730.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family HD-ZIP
Protein Properties Length: 762aa    MW: 83535.7 Da    PI: 5.9461
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004515730.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox68.48.8e-2255110156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     ++k +++t++q++eLe++F+++++p++++r +L+k+lgL+ +qVk+WFqNrR+++k
  XP_004515730.1  55 KKKYHRHTPQQIQELESFFKECPHPDEKQRSDLSKRLGLENKQVKFWFQNRRTQMK 110
                     79999************************************************999 PP

2START179.71.7e-562704932206
                     HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
           START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                     la +a++el+k+ + ++p+W+kss    e +n +e+ ++ ++  +       + +ea +++g+++ +++ lve+lld   +W+e+++    +a t
  XP_004515730.1 270 LAIAAMDELIKMSQPDCPLWMKSSeggkEVLNHEEYARSGSP--FtnpkpngYVTEATKETGLLIINSVALVETLLDAD-RWTEMFPcmiaRAVT 361
                     6789********************666655555555555544..155899999**************************.*************** PP

                     EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE- CS
           START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwveh 169
                     l+vissg      galq+m +e q++splvp R + ++R+++q+ +g+wv+vdvS+d  ++  +  +++ +++lpSg+++++++ng +k+twv+h
  XP_004515730.1 362 LDVISSGmggsrnGALQVMHSEIQLPSPLVPvRQYSVLRFCKQHAEGVWVVVDVSIDIGRNTANGNPYMSCRRLPSGCVLQDMPNGLCKITWVDH 456
                     *************************************************************999******************************* PP

                     EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 170 vdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       ++++ +h+++r+lv+sgla+ga +wvatlqrqce+
  XP_004515730.1 457 SQYDESAVHQIYRPLVNSGLAFGAHRWVATLQRQCEC 493
                     ***********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.05E-2037112IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-2245112IPR009057Homeodomain-like
PROSITE profilePS5007117.97752112IPR001356Homeobox domain
SMARTSM003896.0E-1954116IPR001356Homeobox domain
CDDcd000862.43E-1955112No hitNo description
PfamPF000462.4E-1955110IPR001356Homeobox domain
PROSITE patternPS00027087110IPR017970Homeobox, conserved site
PROSITE profilePS5084845.284260496IPR002913START domain
SuperFamilySSF559617.14E-32263493No hitNo description
CDDcd088756.87E-115266492No hitNo description
SMARTSM002349.3E-41269493IPR002913START domain
PfamPF018522.6E-48270493IPR002913START domain
Gene3DG3DSA:3.30.530.206.1E-4373489IPR023393START-like domain
SuperFamilySSF559613.3E-13512697No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 762 aa     Download sequence    Send to blast
MEGHGEMGLI GENFDSGLLG RMREDEYESR SGSENFDGAS GDDLDAGDDQ PQNKKKKYHR  60
HTPQQIQELE SFFKECPHPD EKQRSDLSKR LGLENKQVKF WFQNRRTQMK TQLERHENMI  120
LRQENEKLRA ENSVMKEAMA NPICSNCGGP AIPGQISMEE HQIRIENARL KEELTRVCTL  180
ANKFLGRPLS ALANMALPSP NSSLELGIGR NGIVSGSSNF GMSMPMGFNM GDGVMGTPPT  240
HSGMTHSGMR SPMGMMGNDA QQERTMLIDL AIAAMDELIK MSQPDCPLWM KSSEGGKEVL  300
NHEEYARSGS PFTNPKPNGY VTEATKETGL LIINSVALVE TLLDADRWTE MFPCMIARAV  360
TLDVISSGMG GSRNGALQVM HSEIQLPSPL VPVRQYSVLR FCKQHAEGVW VVVDVSIDIG  420
RNTANGNPYM SCRRLPSGCV LQDMPNGLCK ITWVDHSQYD ESAVHQIYRP LVNSGLAFGA  480
HRWVATLQRQ CECLAILMST MPSEDPTAIN QAGRRSMLKL AQRMTDYFWS GVCPSTACKW  540
DILHISNMGN SDMKIMSRKH QDNSGESTSI VLSAATSVWL PVSRQRVFDF LREARLRGEW  600
DVLTGGGPMQ EMVHIPKGQS LGNSVCILRG NNASNGNEGN VLYLQDSWTD SSGSMIVYSP  660
INMQSLNMVM NGGDSSFISL LPSGFSILPD GHSNNNCVGT SNDGSGNGGS DNNDSGGCLL  720
TAGIQMLLNN LQTSKLTMES VDAVNALITC TIQKVKDALG VA
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004515730.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150441e-35AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004515730.10.0homeobox-leucine zipper protein ROC6-like isoform X1
RefseqXP_027186734.10.0homeobox-leucine zipper protein ROC6-like isoform X1
RefseqXP_027186735.10.0homeobox-leucine zipper protein ROC6-like isoform X1
RefseqXP_027186736.10.0homeobox-leucine zipper protein ROC6-like isoform X1
SwissprotQ9M2E80.0HDG1_ARATH; Homeobox-leucine zipper protein HDG1
TrEMBLA0A1S2Z6360.0A0A1S2Z636_CICAR; homeobox-leucine zipper protein ROC6-like isoform X1
STRINGXP_004515730.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Horstman A, et al.
    AIL and HDG proteins act antagonistically to control cell proliferation.
    Development, 2015. 142(3): p. 454-64
    [PMID:25564655]