PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004515686.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family HB-other
Protein Properties Length: 193aa    MW: 21647.2 Da    PI: 8.0924
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004515686.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.16.2e-087382354
                    SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox 23 rypsaeereeLAkklgLterqVkvWFqNrRak 54
                    +y+  +++  LAk++gL+ +qV++WF N R +
  XP_004515686.1  7 NYLIDTDKIMLAKQTGLSRNQVSNWFINARVR 38
                    6888889999********************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.961142IPR001356Homeobox domain
SuperFamilySSF466891.37E-10749IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-15846IPR009057Homeodomain-like
CDDcd000862.95E-8843No hitNo description
PfamPF059206.0E-111238IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MSCKFSNYLI DTDKIMLAKQ TGLSRNQVSN WFINARVRLW KPMVEEIHML ESQQTQKEPQ  60
RDENPSTSTD KFQLRSNNNI AENPCNSTDK FHNVAYKRTR NELSNMSVLN QQVGSNGVSM  120
GSNVATSNNG VSLTLGLHQN HGIGLSEPFN MSVAQCFGLA LQPDSYVMST FQSQNRQFGR  180
DLIGGQILHD FVG
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that is involved in the preservation of the spiral phyllotactic arrangement leading to a regular pattern of organ initiation. Required for maintenance of stem cell fate in the shoot apical meristem, and is essential for specifying floral primordia and establishing early internode patterning events during inflorescence development. Acts as transcription repressor of AG expression in floral and inflorescence meristems. Is also responsive of the nuclear import of SHOOT MERISTEMLESS (STM). In the fruit, plays a central role in patterning by negatively regulating SHP expression in order to prevent replum cells from adopting a valve margin cell fate. {ECO:0000269|PubMed:12874117, ECO:0000269|PubMed:12897247, ECO:0000269|PubMed:13678595, ECO:0000269|PubMed:15019989, ECO:0000269|PubMed:15120075, ECO:0000269|PubMed:15155890, ECO:0000269|PubMed:16741748}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004515686.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004515686.11e-143BEL1-like homeodomain protein 9 isoform X1
RefseqXP_012567363.11e-143BEL1-like homeodomain protein 9 isoform X1
RefseqXP_027186728.11e-143BEL1-like homeodomain protein 9 isoform X1
RefseqXP_027186729.11e-143BEL1-like homeodomain protein 9 isoform X1
SwissprotQ9LZM83e-37BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBLA0A1S3DVW31e-142A0A1S3DVW3_CICAR; BEL1-like homeodomain protein 9 isoform X1
STRINGXP_004515686.11e-143(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28103373
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.11e-39TALE family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Pabón-Mora N,Wong GK,Ambrose BA
    Evolution of fruit development genes in flowering plants.
    Front Plant Sci, 2014. 5: p. 300
    [PMID:25018763]
  3. Khan M, et al.
    Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis.
    Plant Physiol., 2015. 169(3): p. 2166-86
    [PMID:26417006]
  4. Andrés F, et al.
    Floral Induction in Arabidopsis by FLOWERING LOCUS T Requires Direct Repression of BLADE-ON-PETIOLE Genes by the Homeodomain Protein PENNYWISE.
    Plant Physiol., 2015. 169(3): p. 2187-99
    [PMID:26417007]
  5. Bencivenga S,Serrano-Mislata A,Bush M,Fox S,Sablowski R
    Control of Oriented Tissue Growth through Repression of Organ Boundary Genes Promotes Stem Morphogenesis.
    Dev. Cell, 2016. 39(2): p. 198-208
    [PMID:27666746]
  6. Sehra B,Franks RG
    Redundant CArG Box Cis-motif Activity Mediates SHATTERPROOF2 Transcriptional Regulation during Arabidopsis thaliana Gynoecium Development.
    Front Plant Sci, 2017. 8: p. 1712
    [PMID:29085379]
  7. Simonini S,Stephenson P,Østergaard L
    A molecular framework controlling style morphology in Brassicaceae.
    Development, 2018.
    [PMID:29440299]