PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004514779.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family Whirly
Protein Properties Length: 269aa    MW: 29921 Da    PI: 9.5929
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004514779.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly206.53e-64902271138
          Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalk 95 
                     s+yk+kaal++ ++ p+f  ldsg+ k++r+G lll++a+++++r+ydW++kq+f++s+ e++++++l+s+esceffhdp++++s+eGkvrk+lk
  XP_004514779.1  90 SIYKGKAALTITPRPPEFMPLDSGAYKISRDGYLLLQFAPSVGPRQYDWNRKQVFSFSVVEMGTVISLGSRESCEFFHDPSKGKSDEGKVRKVLK 184
                     7********************************************************************************************** PP

          Whirly  96 vePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsll 138
                     veP+pdGsG+f+nlsv+n++v+++es+++P++kae avl +++
  XP_004514779.1 185 VEPFPDGSGFFFNLSVQNKIVNVDESITIPITKAELAVLSTIF 227
                     ****************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.103.4E-7479247IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544473.06E-7083269IPR009044ssDNA-binding transcriptional regulator
PfamPF085364.3E-6091225IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0032211Biological Processnegative regulation of telomere maintenance via telomerase
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0009508Cellular Componentplastid chromosome
GO:0009570Cellular Componentchloroplast stroma
GO:0003697Molecular Functionsingle-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0042162Molecular Functiontelomeric DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MSHLHLQLQQ HSPAPTSLSS SSSSSSIFSS LKLCTNNYFS PKSLSFKPLT LTQPIRCRHS  60
DLFETRTNSS TSTPNPSVGA LPPRVYVGHS IYKGKAALTI TPRPPEFMPL DSGAYKISRD  120
GYLLLQFAPS VGPRQYDWNR KQVFSFSVVE MGTVISLGSR ESCEFFHDPS KGKSDEGKVR  180
KVLKVEPFPD GSGFFFNLSV QNKIVNVDES ITIPITKAEL AVLSTIFKFI MPYLLGWHTF  240
VNAINPNPEY SAVVNNANPK YGGDYEWTR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_A1e-975826812219p24: plant transcriptional regulator PBF-2
1l3a_B1e-975826812219p24: plant transcriptional regulator PBF-2
1l3a_C1e-975826812219p24: plant transcriptional regulator PBF-2
1l3a_D1e-975826812219p24: plant transcriptional regulator PBF-2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0516581e-156BT051658.1 Medicago truncatula clone MTYF5_F6_F7_F81G-F-20 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004514779.10.0PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic-like
SwissprotQ9M9S31e-111WHY1_ARATH; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLI3SQW01e-130I3SQW0_LOTJA; Uncharacterized protein
STRINGGLYMA08G40850.11e-121(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF64163251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14410.11e-108ssDNA-binding transcriptional regulator