PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004514215.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family Trihelix
Protein Properties Length: 291aa    MW: 35077.6 Da    PI: 7.1646
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004514215.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix79.25.9e-2548129186
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     +W+ qe+++ + +r+e+++++ ++k++k lWe +s+km+e+g+ rsp+qCk+kw+nl +ryk ++++e +    s++++p++++l+
  XP_004514215.1  48 QWSIQETKEFLMIRSELDQTFMETKRNKLLWEVISNKMKEKGYLRSPEQCKCKWKNLVTRYKGCETMELE----SRQQFPFYNELQ 129
                     7*******************************************************************98....46689*****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122032.73E-2347112No hitNo description
PfamPF138376.9E-2248131No hitNo description
PROSITE profilePS500907.20149105IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MEGHHLHHQH HHHNQQQQQQ QQRQHQQQQH NIIGTSNVNM DITDRFPQWS IQETKEFLMI  60
RSELDQTFME TKRNKLLWEV ISNKMKEKGY LRSPEQCKCK WKNLVTRYKG CETMELESRQ  120
QFPFYNELQA IFTSRMERML WAEAEGGSKK KGVHVSSEDD EELLGNEESE GDHKGNIRKK  180
KRKKGKMVIG GGNIDSGSIS NSLKETLEEF MRQQMQMEAQ WMEAFEAREN ERRLKEMEWR  240
QTMEALENER IMMEQRWRER EEQRRVREEA RAEKRDALIT ALLDKLTRED M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A2e-1245109367DNA binding protein GT-1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1177183RKKKRKK
2179183KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004514215.10.0PREDICTED: trihelix transcription factor GT-3b-like
SwissprotO804508e-73TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLA0A072U0821e-122A0A072U082_MEDTR; Trihelix transcription factor GT-3a, putative
TrEMBLV7B3011e-122V7B301_PHAVU; Uncharacterized protein
STRINGGLYMA18G43190.21e-120(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.12e-55Trihelix family protein