PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004513413.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family HB-other
Protein Properties Length: 520aa    MW: 58923 Da    PI: 6.4657
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004513413.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.12.7e-172175357
                    --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                    kR   t+ ql +Le++++ ++yp++e++ eLA++l Lte+q++ WF+ rR k+k+
  XP_004513413.1 21 KRKLKTPAQLMALENFYNDHKYPTEEMKFELANELVLTEKQISGWFCHRRLKDKR 75
                    78889************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-18375IPR009057Homeodomain-like
PROSITE profilePS5007115.3861676IPR001356Homeobox domain
SMARTSM003892.0E-161880IPR001356Homeobox domain
CDDcd000869.68E-152175No hitNo description
PfamPF000468.3E-152175IPR001356Homeobox domain
SuperFamilySSF466891.15E-152184IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 520 aa     Download sequence    Send to blast
MDEPNEMQLE DNKTSMEKNI KRKLKTPAQL MALENFYNDH KYPTEEMKFE LANELVLTEK  60
QISGWFCHRR LKDKRLMRDE VCANNGRQDR SSGVVQDRGS GLGQDSCGST KHGGDYRYLD  120
PKEVESNGVY NHELSVANMN YAHTNLYTEN DSETDNTSSE NSSSLQERLF LQGHDPYDTE  180
PSRYITQNGA LPPLNPKGYK PSGYLKLKGE IEHAAVTAVK NQLGRNYLED GPLLTVDFDT  240
IPPEAFECQT ANSIKESYHV ANPSLAKRQS NLNSRYDPYF NKSSSQDLQM EGGDFGPSHG  300
SDFQDKQDKK SRQRIKQRTT FQGRAVRTNP LPGKSFPPDL YIDSTVEAPA YNSTRNHRIG  360
AKHGVERMKS DSASNPNDLY EENNNPAIEQ EGPLLHDYNN SNVKNVRTSE YVKSKPSNSI  420
RNSRISMDTE ERGLSERMAK EEKRNGIRKV KKPSHESDGG RIPSKETMVA KRAKVDLLRQ  480
YDIKQEPVAE IEPRKTQRSA VEMPSSFSED ETAETSSSLD
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004513413.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004513413.10.0homeobox-DDT domain protein RLT1-like
TrEMBLA0A1S2Z1P20.0A0A1S2Z1P2_CICAR; homeobox-DDT domain protein RLT1-like
STRINGXP_004513413.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF57923051
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.12e-76HB-other family protein