PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004513340.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family G2-like
Protein Properties Length: 389aa    MW: 44100.7 Da    PI: 7.7543
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004513340.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.3e-32226279255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  XP_004513340.1 226 PRMRWTSSLHNRFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 279
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.04E-15223280IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.4E-29224280IPR009057Homeodomain-like
TIGRFAMsTIGR015575.9E-24226279IPR006447Myb domain, plants
PfamPF002492.7E-7227278IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MLKNQIPDLS LNISLPNSAP SSICTNNTNE GDLDSSFDIW KNIDGYFKSN SDGSTSIKGS  60
SNLQKDTQLS LSNSNPPFEV ESPWKRNFVA RKELTNYEVC DESEILRRPF NGIPLYSGNN  120
SSIIEKDSKF SLYEVQNPSC AINSSNNSCE GFKQISRFNG ITMESLRSQQ FQYLNNHHHH  180
QKYHNHLLQQ NQFGSTIGNY EFGNGFLRSR SMMARQQSNK RNMRAPRMRW TSSLHNRFVH  240
AVELLGGHER ATPKSVLELM DVKDLTLAHV KSHLQMYRTV KNTDKPAASS DGDENFMSLT  300
PPHNQNKNYN VSLDHDLGYT SNNLWANSSS SKGTWTQNGS HDFDEFSTQE ILSSQHINNK  360
LPQGIVRSLK DQNIDGQIPN LEFTLGRSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-18227281458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-18227281458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A7e-18227281357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-18227281357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-18227281357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-18227281357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-18227281458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-18227281458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-18227281458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-18227281458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-18227281458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-18227281458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004513340.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004513340.10.0probable transcription factor KAN4
TrEMBLA0A1S2Z1K70.0A0A1S2Z1K7_CICAR; probable transcription factor KAN4
STRINGXP_004513340.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-46G2-like family protein