PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004513328.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family BBR-BPC
Protein Properties Length: 288aa    MW: 31892.6 Da    PI: 10.2564
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004513328.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind350.63.5e-10712881301
       GAGA_bind   1 mdddgsre.rnkgyyepaaslkenlglqlmssiaerdaki.rernlalsekkaavaerd.........maflqrdkalaernkalverdnkllal 84 
                     md d+  + rn+gyyep +s+k++lglqlmss++e+     +++ + ls+ ++a+++rd         m++ +rd+++++      +rdnk++++
  XP_004513328.1   1 MDGDNGLNiRNWGYYEPVSSFKSHLGLQLMSSMPEKPLLGgHNAAV-LSGGNGAFHHRDiglpqttypMDY-MRDAWISS------QRDNKYMNM 87 
                     888888888*************************998766466666.************************.********......9******** PP

       GAGA_bind  85 llvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvk 179
                      ++ ++      +g++ +++t+s++++q+++ p+l ++  +++      a+p++     +k++ + kkrq  k+pk++kakk+k+ ++++k +++
  XP_004513328.1  88 NMIPTN------PGYSGIPETSSAHHIQMIQPPELLKEERPTE----DAAPPVV-----EKTNGTGKKRQGLKVPKSPKAKKPKRGPRDPK-DEN 166
                     **9886......89999************66555554444422....2334444.....45566677788899************777775.555 PP

       GAGA_bind 180 kesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaa 274
                     + s++++ + +kk++++++ng++lD+s++P+PvCsCtG+++qCY+WG+GGWqSaCCtt+iS+yPLP+stkrrgaRiagrKmS gafkk+LekLaa
  XP_004513328.1 167 TRSVPRTPRVPKKTTEIAINGIDLDISSIPIPVCSCTGTPQQCYRWGSGGWQSACCTTAISIYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAA 261
                     56667899*************************************************************************************** PP

       GAGA_bind 275 eGydlsnpvDLkdhWAkHGtnkfvtir 301
                     eGy++snp+DL+++WAkHGtnkfvtir
  XP_004513328.1 262 EGYNFSNPIDLRTYWAKHGTNKFVTIR 288
                     **************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012263.8E-1581288IPR010409GAGA-binding transcriptional activator
PfamPF062171.8E-1081288IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MDGDNGLNIR NWGYYEPVSS FKSHLGLQLM SSMPEKPLLG GHNAAVLSGG NGAFHHRDIG  60
LPQTTYPMDY MRDAWISSQR DNKYMNMNMI PTNPGYSGIP ETSSAHHIQM IQPPELLKEE  120
RPTEDAAPPV VEKTNGTGKK RQGLKVPKSP KAKKPKRGPR DPKDENTRSV PRTPRVPKKT  180
TEIAINGIDL DISSIPIPVC SCTGTPQQCY RWGSGGWQSA CCTTAISIYP LPMSTKRRGA  240
RIAGRKMSIG AFKKVLEKLA AEGYNFSNPI DLRTYWAKHG TNKFVTIR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00253DAPTransfer from AT2G01930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004513327.10.0PREDICTED: protein BASIC PENTACYSTEINE1-like
RefseqXP_004513328.10.0PREDICTED: protein BASIC PENTACYSTEINE1-like
SwissprotQ9SKD04e-97BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLI1L4051e-174I1L405_SOYBN; Uncharacterized protein
STRINGGLYMA09G30040.41e-174(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01930.26e-92basic pentacysteine1