PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004512413.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family GRF
Protein Properties Length: 346aa    MW: 38641.9 Da    PI: 9.0218
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004512413.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC69.15.8e-2274118145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrCrRtDGKkWRCsr++ +++k+C+rH+ r r rsrk++e+
  XP_004512413.1  74 DPEPGRCRRTDGKKWRCSRDAHPDSKYCDRHMIRRRYRSRKPVES 118
                     79****************************************997 PP

2QLQ53.95.5e-191954237
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                    +FT +Q+q+L++Q+l++KyL a++ vPp+Ll++i+k
  XP_004512413.1 19 PFTVSQWQELEHQALIFKYLKAGLSVPPDLLLPIRK 54
                    9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.5E-101854IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.2E-141953IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.9921954IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.69874118IPR014977WRC domain
PfamPF088799.5E-1975117IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MSVPPPPPSG MWPTTTHPPF TVSQWQELEH QALIFKYLKA GLSVPPDLLL PIRKSLQFIS  60
HRPSSLGYYG KKIDPEPGRC RRTDGKKWRC SRDAHPDSKY CDRHMIRRRY RSRKPVESSS  120
SSSQSQSQSQ SQSSSSVSST SQLVSSIGTT TVSTGSVSVT SNSTFHTLPL HTNGTREGLG  180
FTLGNTIPDM DPMLLPLQGS KKPYRFGLNS EADEHNLLQK DLGTVKYQGY DFTSDGMWYN  240
NMSQIPSNTV SESRSGSTTM TGNYFQQRTT REPELFSLDA ARSKEIVFNS QLCSTGSLKQ  300
DYESPQSLFS DWHWKKDLAS SAAIEYRPNK DFNTDPDANV DSNGTL
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004512413.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4695552e-69CU469555.2 Medicago truncatula chromosome 5 clone mth4-28c15, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004512414.10.0growth-regulating factor 5-like
TrEMBLA0A1S2YZK90.0A0A1S2YZK9_CICAR; growth-regulating factor 5-like
STRINGXP_004512413.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF149481112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.15e-38growth-regulating factor 5