PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004512362.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family Trihelix
Protein Properties Length: 304aa    MW: 36097.7 Da    PI: 8.9141
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004512362.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix88.66.9e-2849130186
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     +W++qe+++ i++r e+e+++ ++k++k+lWe vs+kmrerg++rsp+qCk+kw+nl +ryk  ++++ ++     ++cp+f++l+
  XP_004512362.1  49 QWSQQETREFIAIRAELERDFTASKRNKTLWEVVSSKMRERGYRRSPEQCKCKWKNLVNRYKGKETSDPEH----GKQCPFFEELH 130
                     7****************************************************************999986....678******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.5E-446108IPR001005SANT/Myb domain
PfamPF138373.1E-2448131No hitNo description
CDDcd122032.98E-2748113No hitNo description
PROSITE profilePS500907.750106IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MYGVGGDDAL PARLGIVTPS MLIPVTPSMI SRDMSPTPAR EERLPAQPQW SQQETREFIA  60
IRAELERDFT ASKRNKTLWE VVSSKMRERG YRRSPEQCKC KWKNLVNRYK GKETSDPEHG  120
KQCPFFEELH AVFTQRAHNM QRLLLESETR SAQTKKGVKR LSVDRSSEEF SEEDEVEDDS  180
EDERPARSNN RKRKAGKIAM EKPSRAKSTC SSTSDIQDML KEFFQHQLRM EIQWKEIMER  240
RAHERQLFEQ EWRQSMEKLE RERLMIEQAW REREEQRRLR EESRAERRDA LLTTLLNKLI  300
HESN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A9e-1550120777DNA binding protein GT-1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU9141350.0CU914135.3 Medicago truncatula chromosome 5 clone mth4-3n15, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004512362.10.0PREDICTED: trihelix transcription factor GT-3b-like
TrEMBLA0A0L9URU21e-165A0A0L9URU2_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T3G01e-165A0A0S3T3G0_PHAAN; Uncharacterized protein
STRINGGLYMA01G35370.21e-163(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.12e-42Trihelix family protein