PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004512096.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family GATA
Protein Properties Length: 380aa    MW: 42035.3 Da    PI: 7.0153
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004512096.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.71.6e-18296330135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     Cs+Cg+ kTp+WR gp g ktLCnaCG+++++ +l
  XP_004512096.1 296 CSHCGVQKTPQWRTGPLGAKTLCNACGVRFKSGRL 330
                     *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.0E-16290344IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.569290326IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.24E-13293353No hitNo description
Gene3DG3DSA:3.30.50.101.8E-14294328IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.24E-13295343No hitNo description
PfamPF003202.3E-16296330IPR000679Zinc finger, GATA-type
PROSITE patternPS003440296321IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MLYQTPYPLL FQFHPLPSSS TIQQVPLPQA EKTEMECVET ALKTSLRKDM TVKLNPQTFV  60
DELSCLNAQN GTSCDDFFVD DLLDFSHVIE EQQQQEEEKD SSICVSLKQH NQNHEISNLN  120
STSFSLKDDF CSLPTTDLNV PSDDVADLEW LSHFVEDSDS FSEFSAALPV VTLTEKNPKS  180
VVVVNESEPK PENKPKSPVF SQPCFKTPVQ TKARSKRTRT SVRVWPFGSN SLTESSSSST  240
TTSSSTSSSP TSTLLIYTNL AQNLEKVYSV PEKKPKKIAS FNGSGHGTVA LAPRRCSHCG  300
VQKTPQWRTG PLGAKTLCNA CGVRFKSGRL LPEYRPACSP TFSSELHSNH HRKVLEMRRK  360
KEVVGGVETG LSPSPVVPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004512096.10.0PREDICTED: GATA transcription factor 5
SwissprotQ9FH572e-80GATA5_ARATH; GATA transcription factor 5
TrEMBLG7KGC31e-149G7KGC3_MEDTR; GATA type zinc finger transcription factor family protein
STRINGGLYMA01G37450.11e-136(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.21e-69GATA transcription factor 5