PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004511373.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family CPP
Protein Properties Length: 775aa    MW: 84578.5 Da    PI: 5.9254
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004511373.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.96.2e-16484521340
             TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     +k+CnCkkskClk+YCeCfaag++C e C+C++C+Nk 
  XP_004511373.1 484 CKRCNCKKSKCLKLYCECFAAGVYCIEPCSCQECFNKP 521
                     89**********************************96 PP

2TCR50.63.9e-16568606139
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  XP_004511373.1 568 RHKRGCNCKKSSCLKKYCECYQGGVGCSISCRCEGCKNA 606
                     589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.0E-17482523IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.166483608IPR005172CRC domain
PfamPF036381.5E-11485520IPR005172CRC domain
SMARTSM011144.4E-17568609IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-11570606IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 775 aa     Download sequence    Send to blast
MDTPERNQIN TTLSKFEDSP VFNYINNLSP IRPVKSVHIT QTFNSLSFSS PPSVFTSPHV  60
SSFKESRFLR RHILLDTSKP KDSSEDVNNK VYSSEEAIAD STLSHLNTNE LHESSDQGIS  120
VGNGSVELSS EHAKFSDELP QALQYNCGSP SYDPPLCADE ANSLLELPGE GVSDAAYVPD  180
GCKTDSIESE LHLQGPSQID PKEEGADCDW AGLIPNAADL LIEAEAEAFK GLMQKPSGSS  240
IRLSDFMPLL QQSTNNNDQK MYMIKSVASG SEHEIENHCS EPVALADTDH IQDNLASGSL  300
MTSNPNEQMD DKLVSVTHRG IRRRCLDFEM ASVRRKNSDD NSKTGSSTTQ SEVSNAANEK  360
QLLPTKRNAD SQRCILPGIG LHLNALATLK DHKGLQNEKL TSGRQLSLSN STSLLLSTCH  420
EHQHLSVLSV SISSERELDP SDNGVQPTED CSQASAYMAG EDFNQNSPKK KRRKSEPAGE  480
IEGCKRCNCK KSKCLKLYCE CFAAGVYCIE PCSCQECFNK PIHEDTVLQT RKQIESRNPL  540
AFAPKVIRSS ESVPEVGDDP NKTPASARHK RGCNCKKSSC LKKYCECYQG GVGCSISCRC  600
EGCKNAFGRK DGSAITEMVE GETEEETETS DKGVAEKAIQ KTEIQSIEDH PDSAAVSTPL  660
RLSRPLLPMP FSSKGKPPRS FVTTITGSGY FASQKLAKPD SLWPQSKPFQ TVPDNEMPEI  720
LRGDSSPIAC IKTSSPNGKR ISSPNCEMGS SPSRRGGRKL ILQSIPSFPS LTPHP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1748760514120Protein lin-54 homolog
5fd3_B1e-1748760514120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1468472KKKRR
2468473KKKRRK
3469473KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004511373.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004511373.10.0protein tesmin/TSO1-like CXC 2
TrEMBLA0A1S2YX600.0A0A1S2YX60_CICAR; protein tesmin/TSO1-like CXC 2
STRINGXP_004511373.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26193375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-137TESMIN/TSO1-like CXC 2