PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004509074.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family GRAS
Protein Properties Length: 556aa    MW: 62827.4 Da    PI: 7.7734
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004509074.2genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS303.64.6e-931315532373
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn...sseelaalkl..fsevsPil 91 
                     ++lL++cA+a++++d +laq++L+ l+++a pdgd++qRla  f++AL +r a+  ++++k l   +++++n   +++++++ +l  f++++P++
  XP_004509074.2 131 EQLLVHCADAIETNDVTLAQQILWVLNNIAPPDGDSNQRLANSFLRALTNRAAK--NGTCKMLVEVSNARNNlniETHRFSIIELanFVDLTPWH 223
                     79****************************************************..8888888766666677455555555555589******** PP

            GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg.........skeeleetgerLakfAeelgvpfe 177
                     +f++ +aN  I ea+eg + +Hi+D++ ++++Q p+L++a+asR e +p +++T+ ++++ +            ++ee+g++L +fA++ +v++e
  XP_004509074.2 224 RFGFTAANASIIEATEGFSVIHIVDLSSTHCMQIPTLIDAIASRHEVSPLIKLTVADHANIDqipfhvppmLDLSYEELGSKLVNFARSRNVTLE 318
                     **********************************************************888899999998878899******************* PP

            GRAS 178 fnvl...vakrledleleeLrvkp....gEalaVnlvlqlhrll...................................desvsleserdevLkl 230
                     f+v+   +++ +++l +e+Lrv++    gEal++n++++lh+++                                     +++++s r+ +Lk+
  XP_004509074.2 319 FRVVsssYTNGFASL-IEHLRVQRlvysGEALVINCHMMLHYIPdetlslihdtnlnsnsnsyvydtfsscsssaavtvTTTATTTSLRSLFLKA 412
                     ***966533344444.777887777777*************************************************9988888888999***** PP

            GRAS 231 vkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFk 325
                     v++l P++vv+v++++d++s++++ r+ +a++y +  +d++++ lpr s++r+++E+  + ++i+nv+a+eg +r+er e+ +kW++r+++a F+
  XP_004509074.2 413 VRGLDPTLVVLVDEDVDLTSNNLVCRLRSAFNYLWIPYDTVDTFLPRGSKQRQWYEAN-ICWKIENVIAHEGVQRVERDENIGKWEQRMRNANFQ 506
                     **********************************************************.************************************ PP

            GRAS 326 pvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                      + ++e+ + ++k++l +++  g+ +++e++ +vl+Wk++++v++SaW
  XP_004509074.2 507 GIGFGEECVGEVKAMLDEHA-AGWGLKKEDEHIVLTWKGHNVVFASAW 553
                     ********************.999************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.033104535IPR005202Transcription factor GRAS
PfamPF035141.6E-90131553IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MAHVRQIKYL LSYRYTTKSQ LPNRNNVVAG YFTCYQNPKQ KQCAPTIYRD SNLKIKTTPP  60
KSLRRAYFVA LSMMQFTTSV PYLHQTKTHF SNSNPSSMNK NNQIPNRNTN IKPWFPTSKA  120
LTNFGDTNCM EQLLVHCADA IETNDVTLAQ QILWVLNNIA PPDGDSNQRL ANSFLRALTN  180
RAAKNGTCKM LVEVSNARNN LNIETHRFSI IELANFVDLT PWHRFGFTAA NASIIEATEG  240
FSVIHIVDLS STHCMQIPTL IDAIASRHEV SPLIKLTVAD HANIDQIPFH VPPMLDLSYE  300
ELGSKLVNFA RSRNVTLEFR VVSSSYTNGF ASLIEHLRVQ RLVYSGEALV INCHMMLHYI  360
PDETLSLIHD TNLNSNSNSY VYDTFSSCSS SAAVTVTTTA TTTSLRSLFL KAVRGLDPTL  420
VVLVDEDVDL TSNNLVCRLR SAFNYLWIPY DTVDTFLPRG SKQRQWYEAN ICWKIENVIA  480
HEGVQRVERD ENIGKWEQRM RNANFQGIGF GEECVGEVKA MLDEHAAGWG LKKEDEHIVL  540
TWKGHNVVFA SAWLPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B2e-4913155588474Protein SHORT-ROOT
5b3h_B1e-4913155534420Protein SHORT-ROOT
5b3h_E1e-4913155534420Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004509074.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1377030.0AC137703.43 Medicago truncatula chromosome 8 clone mth2-11d24, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004509074.20.0scarecrow-like protein 32
SwissprotQ9SN221e-170SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A1S2YS740.0A0A1S2YS74_CICAR; scarecrow-like protein 32
STRINGXP_004509074.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-161GRAS family protein