PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004508828.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family M-type_MADS
Protein Properties Length: 248aa    MW: 28602.6 Da    PI: 4.9186
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004508828.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF28.61.9e-09951143
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                    k i+n+  r++tf +R++g+ KK +  S+  + ++++i++  +
  XP_004508828.1  9 KYINNEKVRKITFMNRKKGLTKKVSDFSIKSGGKACLIMYDGD 51
                    5799***********************************9655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.8E-9161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.06E-15177IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.101148IPR002100Transcription factor, MADS-box
CDDcd002665.35E-15283No hitNo description
PRINTSPR004049.3E-5323IPR002100Transcription factor, MADS-box
PfamPF003196.2E-101153IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-52338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MGRAKVAIKY INNEKVRKIT FMNRKKGLTK KVSDFSIKSG GKACLIMYDG DDNVAPTIWP  60
PDPTLVNSML QEYENQKIET SLKIFDIKDY FKIKKEIIEA EILKVKKAIL GNKFPTWDPS  120
FNNMQVEHLT AFMETINAKI QDYFTNHVDL PPNSSTNQLC QLVECDDLEV KPINVCQLME  180
CDDLEVKSIN ERANQFADVD DWTNQLDDDI LNWIRQPDQF SWKDISLLPP TEHESASSNA  240
LTRPKYSF
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004508828.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004508828.10.0uncharacterized protein LOC101509127
TrEMBLA0A1S2YRM70.0A0A1S2YRM7_CICAR; uncharacterized protein LOC101509127
STRINGXP_004508828.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.11e-12M-type_MADS family protein