PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004508794.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family LBD
Protein Properties Length: 302aa    MW: 34192.1 Da    PI: 5.3166
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004508794.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260117.21e-36101091100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rrkC+++C lapyfpa+qpk f nvhklFG+sn++k+lk+l+++++++am+s++ +A+ r + Pv+G+ + i +lq q+   ++el+
  XP_004508794.1  10 ACAACKFQRRKCTPECLLAPYFPADQPKIFLNVHKLFGVSNIVKILKHLEPSQKKIAMDSIIIQANYRDKYPVHGCWEEICRLQYQIWVGEEELH 104
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                     ++ ++
  XP_004508794.1 105 AVYQQ 109
                     98877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.7649110IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-3510106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MTLKGGTTQA CAACKFQRRK CTPECLLAPY FPADQPKIFL NVHKLFGVSN IVKILKHLEP  60
SQKKIAMDSI IIQANYRDKY PVHGCWEEIC RLQYQIWVGE EELHAVYQQL EICRQQQQQQ  120
QLPHDDVTSQ LELGMAAPCS SNALTLFNHT TTQPQTYNNN TVAAAPLSVS QQHSYSNSNS  180
VDYNNSPLYM DSKDNNATNP NLWIQCPYTN NNSNSIIMQP HQLVASESQP LSSVQQGVVE  240
DNYDEMHSFF DTVDDRQSYI YSKEAYESSS EESLKDTRKC TEHVSENELK SAAACFSLTS  300
VN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-2861107111LOB family transfactor Ramosa2.1
5ly0_B5e-2861107111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004508794.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004508794.10.0LOB domain-containing protein 27
TrEMBLA0A1S2YRJ90.0A0A1S2YRJ9_CICAR; LOB domain-containing protein 27
STRINGXP_004508794.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.17e-46LOB domain-containing protein 27