PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004508743.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family Nin-like
Protein Properties Length: 259aa    MW: 30515.5 Da    PI: 4.6817
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004508743.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK84.59.8e-27137187252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      k++s + +s+yF++pi++AA+eL+v+lT LK++CR++GI+RWPhRk+ sl
  XP_004508743.1 137 AKNLSRKIISQYFYMPITQAARELNVGLTFLKKRCRELGIRRWPHRKLMSL 187
                     689*********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.518123207IPR003035RWP-RK domain
PfamPF020422.1E-21139187IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
METMPLIGWN SYTDENPFSF TTYQCFPYSG NSNEYFPVTF PKEEFPNDSY LDSFSVEYCN  60
YIPDPYQSLC IEPMSSSLQD YDFYDVEKGF FGWSEIDAGF ESEKVYLNFT DEKIVNEVKE  120
ELVDVKSGGE ERKCSNAKNL SRKIISQYFY MPITQAAREL NVGLTFLKKR CRELGIRRWP  180
HRKLMSLQTL INNFQDQMKE GGLESAEKLR YAIDALEREK KVVEEMPDMQ LEDGTKRLRQ  240
ACFKANYKKR KLMEDPQMF
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004508743.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004508743.10.0protein RKD1
TrEMBLA0A1S2YRF40.0A0A1S2YRF4_CICAR; protein RKD1
STRINGXP_004508743.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.14e-54RWP-RK domain-containing protein