PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004507711.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family ARR-B
Protein Properties Length: 642aa    MW: 71426.7 Da    PI: 4.9453
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004507711.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like86.33e-27211264155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr +W  eLH++F++av+qL G +kA Pk+il+lm+v+gLt+e+v+SHLQkYRl
  XP_004507711.1 211 KPRFVWDAELHRKFLDAVNQL-GLDKAFPKKILDLMNVEGLTRENVASHLQKYRL 264
                     79*******************.********************************8 PP

2Response_reg81.23.3e-27231311109
                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTT CS
    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaG 93 
                     vl vdD+++ ++ll+++l+k +y +v++++++ +ale+l+e++  +Dl++ D++mp+mdG++ll++   e  +lp+i+++++g++e + + +  G
  XP_004507711.1  23 VLAVDDDKTCLKLLENLLRKCNY-HVTTTTESVKALEMLRENRnmFDLVISDVNMPDMDGFKLLEQVGLEM-DLPVIMLSGNGDKERVMKGVIHG 115
                     799********************.***************99999***********************6644.8********************** PP

                     ESEEEESS--HHHHHH CS
    Response_reg  94 akdflsKpfdpeelvk 109
                     a d+l+Kp+ +eel +
  XP_004507711.1 116 ACDYLMKPIRIEELQN 131
                     *************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.1E-1503635IPR017053Response regulator B-type, plant
SuperFamilySSF521721.31E-3520140IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.2E-4020162No hitNo description
SMARTSM004481.4E-3121133IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.43422137IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.9E-2423131IPR001789Signal transduction response regulator, receiver domain
CDDcd001564.17E-2824136No hitNo description
SuperFamilySSF466891.97E-19208268IPR009057Homeodomain-like
PROSITE profilePS5129411.02208267IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-28209268IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-24211264IPR006447Myb domain, plants
PfamPF002492.7E-7216263IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 642 aa     Download sequence    Send to blast
MTAEGRLVGE EVSGDDFPAG MRVLAVDDDK TCLKLLENLL RKCNYHVTTT TESVKALEML  60
RENRNMFDLV ISDVNMPDMD GFKLLEQVGL EMDLPVIMLS GNGDKERVMK GVIHGACDYL  120
MKPIRIEELQ NIWQHVVRKK IDCKDHNKGT NTNEDKICNM AGVCSQDITS ENIDNKNKML  180
RQKRKEQSDE EDDEEEDNDE ENGEEPSTRK KPRFVWDAEL HRKFLDAVNQ LGLDKAFPKK  240
ILDLMNVEGL TRENVASHLQ KYRLSLKRPA KQARIDGTLG TTDPYLQMGS LGGYGDFCTL  300
SGSRRILSST LPSYASSEIF CRSNASSLLN SRGISSSTLV PPLQSQNINA LKLPMFSAYE  360
NSSFLQRIRA STEINHFQQN NYPTGNMKLS PIDDSSAFAV SSSLSDIIRA TTINNANSYL  420
SCFSSNHLQT HNSGAFMNHS SVGGAAVKSE SFNPGTSGSS NSFDYSRIKE SLQNAAQLSN  480
FASNSSPLSE DFNNDQLSQN SLKFSSHGSH FQKSPIDFSS SRVVAVPLEE TMPCQEGLLG  540
NVVKASCYTQ HQNMSSTFNT LNSLASPNED TQLPEVENLY SDARIESNDD CFLQHMISLE  600
GFVQNNCVSL DDIISETVKK DQNETKSIDR EKEFDACKVG PK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-22207268162ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004507711.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8772826e-80EU877282.1 Cicer arietinum microsatellite NCPGR115 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004507711.10.0two-component response regulator ORR24
SwissprotA2X1N21e-112ORR24_ORYSI; Two-component response regulator ORR24
TrEMBLA0A1S2YP410.0A0A1S2YP41_CICAR; Two-component response regulator
STRINGXP_004507711.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-100response regulator 12