PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004507504.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family GATA
Protein Properties Length: 289aa    MW: 32318.1 Da    PI: 6.0558
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004507504.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.77.5e-19209242134
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                     Cs+C++ kTp+WR gp g+ktLCnaCG+++++ +
  XP_004507504.1 209 CSHCQVQKTPQWRTGPLGPKTLCNACGVRFKSGR 242
                     *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.8E-7524289IPR016679Transcription factor, GATA, plant
SMARTSM004014.7E-15203253IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.187203239IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.43E-14206266No hitNo description
Gene3DG3DSA:3.30.50.101.6E-14207240IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.11E-15208265No hitNo description
PROSITE patternPS003440209234IPR000679Zinc finger, GATA-type
PfamPF003201.5E-16209242IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MEVVVAKALK PSLRTESIFP QTICEEILCL NANNVVVGED FSVDDLLDFS HGEFQHSSVG  60
KEIDDYEEEE DQEKDSVTSG SSHDRTEDDG ISNSTAFSGS AESDSIFAAG LEVPTDDVAD  120
LEWVSHFVDD SLPELSLLYP VRARPEPEPR PSPTETPVHL SLIRKKPRTN KTRKPNCHIW  180
SFNPVLSATK KQRKKAEVQP GGPQFQRRCS HCQVQKTPQW RTGPLGPKTL CNACGVRFKS  240
GRLFPEYRPA SSPTFSGDIH SNSHRKVLEM RRRKETDETA SGLNRVQMV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004507505.10.0PREDICTED: GATA transcription factor 7-like
RefseqXP_012573244.10.0PREDICTED: GATA transcription factor 7-like
RefseqXP_004507504.10.0PREDICTED: GATA transcription factor 7-like
TrEMBLG7JJU11e-168G7JJU1_MEDTR; GATA type zinc finger transcription factor family protein
STRINGGLYMA12G04180.21e-125(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34680.21e-47GATA transcription factor 3