PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004505911.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family WOX
Protein Properties Length: 244aa    MW: 27877.9 Da    PI: 7.3037
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004505911.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.32e-212180357
                    --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                    +R+++tkeq+ +Le+l+++  ++psaee+++++++l    +++ ++V++WFqN++a++++
  XP_004505911.1 21 SRWNPTKEQISVLENLYKQgIKTPSAEEIQQITARLrvygHIEGKNVFYWFQNHKARQRQ 80
                    8*****************99**************************************97 PP

2Wus_type_Homeobox115.82.1e-371982265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +++RW+Pt+eQi +Le+lyk+G++tP++eeiq+ita+L+ yG+ie+kNVfyWFQN+kaR+rqkq
     XP_004505911.1 19 SSSRWNPTKEQISVLENLYKQGIKTPSAEEIQQITARLRVYGHIEGKNVFYWFQNHKARQRQKQ 82
                       689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.41E-141187IPR009057Homeodomain-like
PROSITE profilePS5007111.6931681IPR001356Homeobox domain
SMARTSM003899.4E-81885IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.3E-92180IPR009057Homeodomain-like
PfamPF000463.8E-192180IPR001356Homeobox domain
CDDcd000861.77E-72282No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MDTTGKTEII SSSSSSSSSS SRWNPTKEQI SVLENLYKQG IKTPSAEEIQ QITARLRVYG  60
HIEGKNVFYW FQNHKARQRQ KQKQETIAYF NRFLHRPQPI YTSPNALCTP YCVPQAQSEI  120
SYYPKNQKVL LPAAAVSYRR NQSEKVMSNG MSNICNNPMV YEGMQMQQRM CHDYHEFSYS  180
NQETLDLFPL HPTGILEGKT TTEHVSVSAD DSSSDTHHSG SPDIIQDHDN QPFFDFFNNS  240
GKSC
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004505911.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004505911.20.0WUSCHEL-related homeobox 2
TrEMBLA0A1S2YJX40.0A0A1S2YJX4_CICAR; WUSCHEL-related homeobox 2
STRINGXP_004505911.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.14e-45WUSCHEL related homeobox 2