PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004505393.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family WOX
Protein Properties Length: 375aa    MW: 41528.8 Da    PI: 6.3188
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004505393.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.83.9e-1854114257
                     T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                     ++R+++++eq+++Le+ F++   +p +ee++++ ++l    ++ +++V++WFqNr+ + k+
  XP_004505393.1  54 KPRWNPKPEQIRILEAIFNSgMVNPPREEIRKIRAQLqeygQVGDANVFYWFQNRKSRSKH 114
                     89*****************99*************************************995 PP

2Wus_type_Homeobox111.93.3e-3653115264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++RW+P+peQi+iLe++++sG+++P++eei++i+a+L+eyG+++d+NVfyWFQNrk+R+++k
     XP_004505393.1  53 PKPRWNPKPEQIRILEAIFNSGMVNPPREEIRKIRAQLQEYGQVGDANVFYWFQNRKSRSKHK 115
                        689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-740113IPR009057Homeodomain-like
PROSITE profilePS5007110.70650115IPR001356Homeobox domain
SuperFamilySSF466893.17E-1250117IPR009057Homeodomain-like
SMARTSM003894.8E-952119IPR001356Homeobox domain
CDDcd000861.11E-853115No hitNo description
PfamPF000469.0E-1654114IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MASSNKHWPS MFKKSSKTSN HLNWQHGINS SLLSTAFQRT PTSGAGDERS PEPKPRWNPK  60
PEQIRILEAI FNSGMVNPPR EEIRKIRAQL QEYGQVGDAN VFYWFQNRKS RSKHKLRHLH  120
NSKTNKNKNP ESSNSSNSLP QITAPPSSSS SDKKANNEFS NIGFSNGVVV SNSPTTTTSV  180
DQNQASGFFQ TPFYNFPVEN NNNDGMTTQG FYLPEFSNII HHQDLPQQNV VPLVNDQIMI  240
MNFANENRNG TSSSMKDQQG QDIQDPQLSF CDTSASSTED PTLVPHIPIT NAADVTVPPS  300
ITDQLQGVGE EADGRAKCTV IINDVVFEVD VGPFNVREAF GDGAVLFDST GHPILTDDWG  360
VTLHSLHHGA SYYLI
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004505393.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004505393.10.0WUSCHEL-related homeobox 9-like isoform X2
TrEMBLA0A1S2YJD30.0A0A1S2YJD3_CICAR; WUSCHEL-related homeobox 9-like isoform X2
STRINGXP_004505393.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38243361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45980.16e-62WUSCHEL related homeobox 8