PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004503448.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family CPP
Protein Properties Length: 561aa    MW: 60221.8 Da    PI: 6.7338
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004503448.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR461e-1489127241
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                     ++k+CnCk+skClk+YCeCfa+g +C+  C+C +C+N+ +
  XP_004503448.1  89 KQKQCNCKHSKCLKLYCECFASGIYCDG-CNCVNCFNNVD 127
                     89**************************.********986 PP

2TCR512.9e-16173212140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  XP_004503448.1 173 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 212
                     589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.6E-1788128IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.91889213IPR005172CRC domain
PfamPF036382.8E-1190125IPR005172CRC domain
SMARTSM011148.4E-20173214IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-12176211IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 561 aa     Download sequence    Send to blast
MGEDEGSDCP PQNAPLDAVS TATPKKLARQ LDFNAFPGGI PVTSPLPEQT QPPLTTTLPS  60
LPSAKFVKPE SPKSKTRPNF ETKDVTPKKQ KQCNCKHSKC LKLYCECFAS GIYCDGCNCV  120
NCFNNVDNEA ARREAVEATL ERNPNAFRPK IASSPHGTRD SKEEAGEVLI LGKHNKGCHC  180
KKSGCLKKYC ECFQANILCS ENCKCMDCKN FEGSDERQAL FHGDQNNNMA YIQQAANAAI  240
TGAIGSSGYS SPPVSRKRKG PELWPSIKDP SVGKLAQQAN LVRSPAAPSS SLSPIPGARV  300
GPSTLGPSKF MYRSLLADII QPQHLMELCT VLVLASGQAT KTLADQKNLM DKHTEDQTET  360
SLASSNQAQL PNQMEADVEK ATADDCSSAN QTDKTSPENS SSDGGDVPKG RPMSPGTLAL  420
MCDEQDTMFM TSAPSIGSMG HACNTSSQLP YGRGATEVYA EQERIVLTKL RDFLNRVITM  480
GEINETKCSS LARSELEIQK DPIINSTENA STEAVHQQGL GATSNGIAKA VANTTNTITS  540
TSLVPCSFVP ENGETKPKVE K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A7e-319022211132Protein lin-54 homolog
5fd3_B7e-319022211132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004503448.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-108AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004503448.10.0protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A1S2YE170.0A0A1S2YE17_CICAR; protein tesmin/TSO1-like CXC 5
STRINGXP_004503448.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26263379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-168Tesmin/TSO1-like CXC domain-containing protein