PlantRegMap
Plant Transcription Factor Database
PlantTFDB
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004503229.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family GeBP
Protein Properties Length: 399aa    MW: 44780 Da    PI: 5.4358
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004503229.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57395.45.7e-30176269197
          DUF573   1 klfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskki 95 
                     k+fqrl+se+De+v+Lq+l+df+aktg +p ++++ fyefvkk i+++v+  ql  KirrLK+Kf++kvk    gk p+ +k+ + k+fel  ki
  XP_004503229.1 176 KYFQRLFSEDDELVILQALVDFTAKTGNDPCKHLTVFYEFVKKLIHVEVTIGQLRYKIRRLKQKFHNKVKS---GKPPTSAKPIEIKAFELGLKI 267
                     68******************************************************************999...********************* PP

          DUF573  96 Wg 97 
                     Wg
  XP_004503229.1 268 WG 269
                     *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045048.8E-24178269IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0016592Cellular Componentmediator complex
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MAKKRHISQL DEPPIPASKD DHKPPQQEHI TDDQEEEEGS TSSQAASSSE QVEEHEEEED  60
DDEEEDIQQT PSQPASKNHP PPSSNSHPKS SSSSEETDSE SESDPEPNTK LKPLPSKPIK  120
SKPQAQASPP PTKSGTKRPI NNDAKQLNKK KKTTAADEDD KEPEDDVTKT GEDSKKYFQR  180
LFSEDDELVI LQALVDFTAK TGNDPCKHLT VFYEFVKKLI HVEVTIGQLR YKIRRLKQKF  240
HNKVKSGKPP TSAKPIEIKA FELGLKIWGD KPNRKSLKKE PAAKKPTTTK KLVMEPDSPL  300
VVLNESKKAE ESSGKIDASD ANLILNEMVR FDRSAGFTGL NLDAINKAVV LLDESQRDEF  360
EGRWKKLHIA ELELFTRRAE LVEEQTCLIL DALRSSLSH
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004503229.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004503229.10.0GLABROUS1 enhancer-binding protein-like
TrEMBLA0A1S2YDH50.0A0A1S2YDH5_CICAR; GLABROUS1 enhancer-binding protein-like
STRINGXP_004503229.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25210.18e-28DNA-binding storekeeper protein-related transcriptional regulator