PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004503104.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family G2-like
Protein Properties Length: 469aa    MW: 51548.9 Da    PI: 8.38
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004503104.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.7e-32285338255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  XP_004503104.1 285 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 338
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-15282338IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28283338IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-23285338IPR006447Myb domain, plants
PfamPF002498.8E-7286337IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MPLEGIFIES TSTPPDLSLH ISPPTTSNSS SSLICNNTTQ LLNYEPHNSS TTNFVSSRTN  60
LSQAQAQAHT ELSLGRNFSQ EQPQRPPQQQ QQQQPHNPYY QSHFPHLQNH HNSTTPTTST  120
TTSTSSMNHI NYGVSLLDMS SSSSEGLRPI KGIPVYHNRS FPFLPMEHSR DKDHQQHPKM  180
CLYHHMPNST PSLSSSSSSL SPYIAGGLDP MSFLNSGGSA AAYHRAAAAA TRFNGISSKP  240
FKSHIPLHHH HSHYGVGIGP TDSSSGLMRS RFLPKLPTKR SMRAPRMRWT STLHARFVHA  300
VELLGGHERA TPKSVLELMD VKDLTLAHVK SHLQMYRTVK TTDKPAASSG LSDGSGEDDV  360
PQIGSNGGNR QFSDQRGVTV QQDMDYSSNN TLWSNSSSSR EPWPQTNSND IDGFRPTIFQ  420
SQPIAGGHQI QECDSNQLKN NLSGSNLECK NPSLEFTLGI PDWNGKGQA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-16286340458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-16286340458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-16286340357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-16286340357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-16286340357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-16286340357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-16286340458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-16286340458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-16286340458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-16286340458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-16286340458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-16286340458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004503104.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004503104.10.0transcription repressor KAN1 isoform X1
TrEMBLA0A1S2YEJ60.0A0A1S2YEJ6_CICAR; transcription repressor KAN1 isoform X1
STRINGXP_004503104.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.17e-68G2-like family protein