PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004503052.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family GRF
Protein Properties Length: 577aa    MW: 63185.7 Da    PI: 7.015
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004503052.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.74.7e-24183225244
             WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                      epgrCrRtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  XP_004503052.1 183 LEPGRCRRTDGKKWRCSRDVAPNHKYCERHMHRGRPRSRKPVE 225
                     69**************************************987 PP

2QLQ50.75.4e-18125156233
             QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlq 33 
                     +FT aQ+++L++Q+++yKyL+a++P+P++Ll 
  XP_004503052.1 125 PFTIAQWNELERQAMIYKYLMASLPIPSDLLS 156
                     9*****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.1E-7124160IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.2E-12125155IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.212125160IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.673182226IPR014977WRC domain
PfamPF088794.0E-20184225IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 577 aa     Download sequence    Send to blast
MSEFRVQDKE PSSSTKKPTT TNNNIVVGSV FKVESFEGSP NKMMMMQHHN DNHHHHHRSS  60
FHNDDSSVAG PTMPFSDGYS SLSAATIDGV SLNLQPFHSI SSYNNITSAT TTTLETPGEM  120
GAVYPFTIAQ WNELERQAMI YKYLMASLPI PSDLLSFMPT SSHSSSNGGG FNMKSSSSSN  180
TDLEPGRCRR TDGKKWRCSR DVAPNHKYCE RHMHRGRPRS RKPVELHTNY DNNNNNNSHQ  240
IKKARHDSNP FHLPDVTLAI PNSTTRKYGS SSHSLASNTF HPYLQSSLSL DNNSFGVKTS  300
SFVSSSKRPR GLGWMLNGDT ISLAVCDSGW QPLMHNKIGM TTESSYHNNN TESHYLNSFP  360
LYNNNNNTSE LTQQQKPLPL FLNPLVVPTQ TLQSEKPRGF TLFDAWPNTE TLETNTNNNN  420
ASSSIGKLSL TSLDISMGGC VMSEENQEMS TIDMGLGLME EPNENTSNDD DGNKIALSNW  480
LNQETWVGSN SILGGPLAEV LRPSTVTTMS DPTTNSNPSS PATKLVESSG TLGTANAMVS  540
SSPSGVLQNK TLASFSDSSG NSSPTVASSR TKLSKFN
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004503052.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004503052.10.0growth-regulating factor 1
TrEMBLA0A1S2YD260.0A0A1S2YD26_CICAR; growth-regulating factor 1
STRINGXP_004503052.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.12e-36growth-regulating factor 7