PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004501488.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family HD-ZIP
Protein Properties Length: 270aa    MW: 30239.9 Da    PI: 8.1417
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004501488.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.88.9e-19106160256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ ++tk+q + Lee F+ +++++ +e++eLA+kl+L +rqV vWFqNrRa+ k
  XP_004501488.1 106 RKKLRLTKQQSQLLEETFKDHSTLNPKEKQELARKLNLRTRQVEVWFQNRRARTK 160
                     78889************************************************98 PP

2HD-ZIP_I/II114.95e-37106194189
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                     +kk+rl+k+q++lLEe+F+ +++L+p++K+elar+L+l++rqv+vWFqnrRARtk+k++E+d+e Lk++y++l+een+rLe+e ++L++
  XP_004501488.1 106 RKKLRLTKQQSQLLEETFKDHSTLNPKEKQELARKLNLRTRQVEVWFQNRRARTKLKKTEMDCEELKKCYETLTEENKRLENELKDLKS 194
                     69*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-1996163IPR009057Homeodomain-like
PROSITE profilePS5007118.058102162IPR001356Homeobox domain
SuperFamilySSF466896.42E-18103170IPR009057Homeodomain-like
SMARTSM003891.0E-15104166IPR001356Homeobox domain
CDDcd000862.24E-17106163No hitNo description
PfamPF000462.9E-16106160IPR001356Homeobox domain
PROSITE patternPS000270137160IPR017970Homeobox, conserved site
CDDcd146860.00556155194No hitNo description
PfamPF021834.1E-7162196IPR003106Leucine zipper, homeobox-associated
SMARTSM003403.2E-15162205IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MGFDISLGLG LGLHEQSHKK KDDDPFNKAN PIISLTLGVG GSPSHASSTC SLQLSSFSNS  60
STNISIKRER DSEELTHVPA AYVENNNINP SKVLVDDVDE NGNTNRKKLR LTKQQSQLLE  120
ETFKDHSTLN PKEKQELARK LNLRTRQVEV WFQNRRARTK LKKTEMDCEE LKKCYETLTE  180
ENKRLENELK DLKSMKTTDA PFNHMQLPVA GLTICPSCNR ICTGSGGDEN SNIGPSPTTT  240
LLLSPKPHIH FYTNNSNNYS FTQSFATIAS
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004501488.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004501488.10.0homeobox-leucine zipper protein HAT9-like
SwissprotP466048e-55HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A1S2Y9H70.0A0A1S2Y9H7_CICAR; homeobox-leucine zipper protein HAT9-like
STRINGXP_004501488.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.17e-56HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]