PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004500773.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family GATA
Protein Properties Length: 304aa    MW: 34049.2 Da    PI: 6.9401
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004500773.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.91.4e-18220253134
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                     Cs+C++ kTp+WR gp g ktLCnaCG++y++ +
  XP_004500773.1 220 CSHCQVDKTPQWRTGPLGAKTLCNACGVRYKSGR 253
                     *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.3E-8119303IPR016679Transcription factor, GATA, plant
SuperFamilySSF577164.09E-14213276No hitNo description
PROSITE profilePS5011411.319214250IPR000679Zinc finger, GATA-type
SMARTSM004013.8E-14214268IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.9E-14218251IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.06E-14219267No hitNo description
PfamPF003201.6E-16220253IPR000679Zinc finger, GATA-type
PROSITE patternPS003440220245IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MEFAVAKALK PSLRREFVFQ QTLGEEVFCL NTNTVVTGED FSVDDLLDFS NNDTLHHEHH  60
NDDEEKDSLS LSSHSLSDDS NSNSTDASYD SIFSTELLVP DDDVADLEWV SHFVDDSLPE  120
LSLLYPVQIQ SNACPQHETK HVKITRLPSE NVKIITKTRT AKNRKPNPHV WTFSPLLLRP  180
FFTSPPLVSG EPPAKKQKKK AEAQAVVGEA QDQAQLQRRC SHCQVDKTPQ WRTGPLGAKT  240
LCNACGVRYK SGRLFSEYRP ACSPTFSSKV HSNSHRKVLE IRRRKGMVGP ETGLSAQTQM  300
VTTC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004500773.10.0PREDICTED: GATA transcription factor 7
TrEMBLG7J7S11e-152G7J7S1_MEDTR; GATA type zinc finger transcription factor family protein
STRINGGLYMA06G01110.11e-123(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.26e-44GATA transcription factor 5