PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004500442.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family LBD
Protein Properties Length: 177aa    MW: 19877.6 Da    PI: 5.6634
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004500442.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.52.6e-4461051100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +Ca+Ck+lrr+Ca++C++apyfp+e+p+kfa+vhk+FGasnv+k+l++lp ++r++a++slvyeA+ar+rdPvyG+vg i+ lq+q+ ql+ +la
  XP_004500442.1   6 PCASCKLLRRRCAQECIFAPYFPSEDPRKFAIVHKVFGASNVSKMLQELPIHQRSEAVNSLVYEANARVRDPVYGCVGAISYLQNQVTQLQMQLA 100
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_004500442.1 101 VAQAE 105
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.1065106IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-436103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MGGSSPCASC KLLRRRCAQE CIFAPYFPSE DPRKFAIVHK VFGASNVSKM LQELPIHQRS  60
EAVNSLVYEA NARVRDPVYG CVGAISYLQN QVTQLQMQLA VAQAEILCIQ MQQDPVSVTS  120
SLPTYVDQDD KLMLLSENSN CYEPHLLPQY PNFPSSSSSS SNVFQDYEPL KRESFWT
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU6515811e-108CU651581.9 M.truncatula DNA sequence from clone MTH2-66L10 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004500442.11e-130PREDICTED: LOB domain-containing protein 12 isoform X1
SwissprotQ8LBW38e-77LBD12_ARATH; LOB domain-containing protein 12
TrEMBLG7J0R01e-104G7J0R0_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGGLYMA18G06530.13e-93(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-76LBD family protein