PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004498785.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family ARR-B
Protein Properties Length: 567aa    MW: 63651.8 Da    PI: 7.0321
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004498785.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.33.5e-28202255155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr++W+ eLH++Fv av++L G +kA+Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  XP_004498785.1 202 KPRVVWSVELHRKFVAAVNHL-GVDKAVPKKILDLMNVEKLTRENVASHLQKYRL 255
                     79*******************.********************************8 PP

2Response_reg74.54e-25231281106
                     EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTT CS
    Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaG 93 
                     vl vdD+++ +++l+++l++ +y +v++a+++  al+ll+e++  +Dl++  + mp+mdG++ll+     e++lp+i+++a+++++++ + +  G
  XP_004498785.1  23 VLAVDDDRTCLKILERLLQRCQY-HVTTAQNAITALNLLRENKnnFDLVISNVHMPDMDGFQLLELVGL-EMDLPVIMFSANDDPKMVMKGIAHG 115
                     799********************.***************888888*******************87754.558********************** PP

                     ESEEEESS--HHH CS
    Response_reg  94 akdflsKpfdpee 106
                     a d+l Kp+ ++e
  XP_004498785.1 116 ACDYLLKPVRMKE 128
                     ********98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.3E-1533561IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23006.2E-4120159No hitNo description
SuperFamilySSF521724.27E-3520144IPR011006CheY-like superfamily
SMARTSM004481.6E-3021133IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.78722137IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.6E-2223129IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.24E-2624137No hitNo description
PROSITE profilePS5129412.975199258IPR017930Myb domain
SuperFamilySSF466898.24E-20199259IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-29199260IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-25202255IPR006447Myb domain, plants
PfamPF002495.7E-7204254IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    Send to blast
MTVVVKDDKM NDLKDQFPIG MRVLAVDDDR TCLKILERLL QRCQYHVTTA QNAITALNLL  60
RENKNNFDLV ISNVHMPDMD GFQLLELVGL EMDLPVIMFS ANDDPKMVMK GIAHGACDYL  120
LKPVRMKEVQ IIWQHVIRKK KTCKTSNQNV PNSDSGNGID SAVTANSDQN VKPSKKRKDQ  180
SGDDGEENDD DHDNEDPTAP KKPRVVWSVE LHRKFVAAVN HLGVDKAVPK KILDLMNVEK  240
LTRENVASHL QKYRLYLKKL STVPNQQANM EAALASSDIS YSRLNSLNGV GGNLHTLSAS  300
RQFHNNNNPF RTFPSNGMTN ILNPNVHGIA SSGTHQLSHT HNDQLKFQSV VPRANPINLD  360
QLQHNRGISP MQNVTNKLSN YKPKVPCSVF DISNKPLLLE ANPQDKQYKI NLASHQPPQY  420
NDIWSNTMQL PHDSMNSQAV VFTSTNNVAF QDWDSNNNIH DDGSYHSQAI GNSVGTMVPV  480
ESEGNLAYNY CDHLQMKPDA IAELTEYNSL KPHQVFMMNH MKGQNTGISH NLGSLEDLVC  540
DMIKQKQEKV KSMDGYLYEN YSGGTSM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-26198261164ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004498785.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004498785.10.0two-component response regulator ARR10 isoform X1
SwissprotA2X1N21e-121ORR24_ORYSI; Two-component response regulator ORR24
SwissprotB8AEH11e-120ORR23_ORYSI; Two-component response regulator ORR23
TrEMBLA0A1S2Y3I50.0A0A1S2Y3I5_CICAR; Two-component response regulator
STRINGXP_004498785.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-116response regulator 12