PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004498660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family CPP
Protein Properties Length: 869aa    MW: 94551.3 Da    PI: 6.6982
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004498660.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR491.2e-15498534339
             TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     +kgC+CkkskClk+YC+Cf ag +C+e C C++C N+
  XP_004498660.1 498 SKGCHCKKSKCLKLYCDCFGAGIYCGEGCACQSCGNR 534
                     69*********************************97 PP

2TCR48.91.3e-15584622139
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     ++k+gCnCk+skC kkYCeCf+a++ Cs+ C+C++CkN 
  XP_004498660.1 584 RHKRGCNCKRSKCTKKYCECFQANVGCSSGCRCDGCKNV 622
                     589***********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.2E-13496537IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163433.927497624IPR005172CRC domain
PfamPF036384.5E-12499534IPR005172CRC domain
SMARTSM011144.6E-16584625IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.2E-11586621IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 869 aa     Download sequence    Send to blast
MDSPEPSNIK TTSSSSLSTL NASSSQSPQL QESPFLRFVN TLSPIKPIKA THVVHGFLGL  60
NSPPLVFKSP RISGLRETQY LERPQGTHLS DGGISQSDIG GNSIVEARGR LEKLKTQQPL  120
LEGFITDTPK DFDINIDANT QSCSPPPSVD KYLADPEDDQ MYSVNPEMEQ STDAAVESSL  180
TESKKVILKF DKEHGPSNRA EELLPLSEES NMVHQERAAY VEEPANVEGE RNGAEWISQE  240
HTVLDSSSGA DVFDQHHYHD SHPQCAGNDQ RHHSDCTPQL MPDHNQVVKE FENCNEMVST  300
SQVNSENIPQ DGSEASLKYH SIRRRCLQFE EAASIDLGGT KSHVKSNATS SNMKMVPVTG  360
SKPPGIGLHL NSIINAMPAS GASTTAVRLS NGLQGIKSKP TISLHKVENV TQSSILSNID  420
GQSVIDARNE IHETDASVAA DSFISESSIL TEPIALYPEN AHDKRRLSPT DTENTEEFNH  480
PSTSKKKKKT ITDDGGGSKG CHCKKSKCLK LYCDCFGAGI YCGEGCACQS CGNRIEFEEK  540
VVETKQHIES RNPNAFAPKI VQCVADVPLN NMEDVSMTTP ASARHKRGCN CKRSKCTKKY  600
CECFQANVGC SSGCRCDGCK NVFGKKEDYV AIEHTSSIET ESSIIEEGLD DKLYNRQKMV  660
VSRTGLLRAP NHLSPLTPSL QCSDQGKQAA KSRLASANWT KSSKKSRSSL AHTARNDSQK  720
NAPPCVSLKE NEWTDIVPYQ PSNVCGIRQL SGGSLRWHSS SPITPSANFG DESNGKLFDI  780
LEDETPDVLK ETSTPIKSVK ANSPIHKRVS PPQSHLLRIG SSSSGGGLRS GRKFILQSVP  840
SFPPLTPCAD SKVNCNSNED SSNNAKKVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-1649962212121Protein lin-54 homolog
5fd3_B2e-1649962212121Protein lin-54 homolog
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004498660.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4555171e-105DQ455517.1 Medicago truncatula cDNA-AFLP fragment BT42M33_467 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004498660.10.0protein tesmin/TSO1-like CXC 2 isoform X1
TrEMBLA0A1S2Y5370.0A0A1S2Y537_CICAR; protein tesmin/TSO1-like CXC 2 isoform X1
STRINGXP_004498660.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85652841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.11e-36Tesmin/TSO1-like CXC domain-containing protein