PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004497887.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family HD-ZIP
Protein Properties Length: 305aa    MW: 34261.2 Da    PI: 6.5207
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004497887.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.21.2e-17159213256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++k+q   Lee F+++ +++ +++  LAk+l+L  rqV vWFqNrRa+ k
  XP_004497887.1 159 RKKLRLSKDQSAFLEESFKEHTTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 213
                     778899***********************************************98 PP

2HD-ZIP_I/II1278.2e-41159249192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     +kk+rlsk+q+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  XP_004497887.1 159 RKKLRLSKDQSAFLEESFKEHTTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELR-ALK 249
                     69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.0E-487116IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.602.4E-17144209IPR009057Homeodomain-like
SuperFamilySSF466895.43E-18149216IPR009057Homeodomain-like
PROSITE profilePS5007117.022155215IPR001356Homeobox domain
SMARTSM003891.3E-15157219IPR001356Homeobox domain
CDDcd000862.03E-15159216No hitNo description
PfamPF000463.9E-15159213IPR001356Homeobox domain
PROSITE patternPS000270190213IPR017970Homeobox, conserved site
CDDcd146860.00423208247No hitNo description
PfamPF021835.9E-11215249IPR003106Leucine zipper, homeobox-associated
SMARTSM003404.5E-26215258IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MELALSLGDT PKLPFSFLDK PTSNLVASED PLPSNFFSTQ GKTSEEKRGS SDPPIQLDLL  60
PFTPVLRSHH PSSQLSIPWL TQPCGPVREL DVNRFPATTE EADDGASLSS PNSEISPFQM  120
DFSMRNNNGD GAGRNSSREG GADRNSTSDD DEEENGSTRK KLRLSKDQSA FLEESFKEHT  180
TLNPKQKLAL AKQLNLRPRQ VEVWFQNRRA RTKLKQTEVD CEYLKRCCET LTEENRRLQK  240
ELQELRALKT SQPFYMQLPA TTLTMCPSCE RVATNSCNNN TRPKILPFSN VQAQSQQAQA  300
HQISS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1157163TRKKLRL
2207215RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004497887.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150411e-54AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004497887.10.0homeobox-leucine zipper protein HOX11-like
SwissprotP466652e-85HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A1S2Y1J80.0A0A1S2Y1J8_CICAR; homeobox-leucine zipper protein HOX11-like
STRINGXP_004497887.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-74homeobox from Arabidopsis thaliana