PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004497769.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family LBD
Protein Properties Length: 281aa    MW: 31492.2 Da    PI: 6.3903
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004497769.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260119.32.1e-3711109199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCa+Ck++rrkC+kdC+lapyfpa++pk+f n+h+l+G+s ++kllk+++++++++am+s++ye+++r   P+yG++gvi+ lq +l++++ el+
  XP_004497769.1  11 ACASCKFQRRKCSKDCPLAPYFPANKPKTFSNAHRLYGVSSISKLLKRINNDKKDEAMTSIIYESNIRSMFPIYGCTGVINILQGKLHNARLELN 105
                     7*********************************************************************************************9 PP

          DUF260  96 llke 99 
                     ++++
  XP_004497769.1 106 YIQN 109
                     9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.13110111IPR004883Lateral organ boundaries, LOB
PfamPF031954.2E-3511108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MDINKRSSNK ACASCKFQRR KCSKDCPLAP YFPANKPKTF SNAHRLYGVS SISKLLKRIN  60
NDKKDEAMTS IIYESNIRSM FPIYGCTGVI NILQGKLHNA RLELNYIQNL LNICKQNYAS  120
QQQNLLPMGN NFISMPSTSC QIPNDPICNN IGDRSYFYDN SENNNFMLSH IIPNDVNNIT  180
SIDSKNELEV NVETGVSGVF SNGADIQLME ENSNLMATQG DLEHNYFGVD VQSAYDDYDT  240
ELSRLFHGEQ HPPITPKDAP KSSSVGSGEQ ELDKNSKHGD K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-2681058105LOB family transfactor Ramosa2.1
5ly0_B3e-2681058105LOB family transfactor Ramosa2.1
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004497769.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004497769.10.0LOB domain-containing protein 12-like
TrEMBLA0A1S2Y2J70.0A0A1S2Y2J7_CICAR; LOB domain-containing protein 12-like
STRINGXP_004497769.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.19e-35LOB domain-containing protein 27