PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004496640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family bHLH
Protein Properties Length: 237aa    MW: 27251.1 Da    PI: 9.6439
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004496640.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH31.92.4e-1070121255
                     HHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
             HLH   2 rrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                     ++ h ++E++RR+++ +  + Lr+llP ++   ++K s ++   +Av+YI++L+
  XP_004496640.1  70 KMVHRQIEKQRRQEMATLHASLRSLLPLQF--IKGKRSLSDQMNEAVNYINHLK 121
                     678*************************65..********************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000833.42E-666125No hitNo description
SuperFamilySSF474591.7E-1068136IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088812.14468120IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.106.7E-970136IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000102.4E-770120IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MFPLQPSNEL SIPLSNTIHH QQNHKISQDL IPHDYDSLLL DFSHKKLSTT TLPPRKLSHT  60
NNLINSNKEK MVHRQIEKQR RQEMATLHAS LRSLLPLQFI KGKRSLSDQM NEAVNYINHL  120
KKNIKELGDK RDEMKKISNI PNFKRSYASC NFTIHKNNGS VGIEITSSGF REEGVPLYKL  180
MEQFLKEGFE VVSCFSIQVN GRLLHSLQCE ANNSDSVDLS ELRRKFSNMN PSFSCSD
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004496640.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004496640.11e-175transcription factor bHLH118-like isoform X1
TrEMBLA0A1S2Y0P31e-173A0A1S2Y0P3_CICAR; transcription factor bHLH118-like isoform X1
STRINGXP_004496640.11e-174(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF79233125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25400.11e-36bHLH family protein