PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004496593.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family HD-ZIP
Protein Properties Length: 790aa    MW: 86829.7 Da    PI: 5.8901
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004496593.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox664.9e-2195150156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t++q++eLe++F+++++p++++r +L+k+lgL+ +qVk+WFqNrR+++k
  XP_004496593.1  95 KKRYHRHTPNQIQELESFFKECPHPDEKQRLDLSKRLGLENKQVKFWFQNRRTQMK 150
                     688999***********************************************999 PP

2START171.36.1e-543015242206
                     HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGG...CT-TT-SEEEEEEE CS
           START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddke...qWdetlakaetlev 84 
                     la++a++el+k+a+ ++p W ks     +++n +e+ + f++  +     +  ea r+sg+v+ ++  l+e+l+d ++    ++ ++a+a  l+v
  XP_004496593.1 301 LALAAMEELLKMAQTDSPIWIKSLdgerDILNHEEYARLFSSCVGskpngFVAEATRESGIVIINSLALMETLMDANRyadMFQSMIARAINLDV 395
                     6899************************************66444899999**************************88888888888******* PP

                     ECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE- CS
           START  85 issg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdl 172
                     +s g      ga++lm aelq+lsplvp R + f+R+++q+ +g+w++vdvS++   +  + ++++ +++lpSg+++++++ng+skvtw+eh+++
  XP_004496593.1 396 LSGGiggtrnGAIHLMHAELQLLSPLVPvRHVRFLRFCKQHAEGVWAVVDVSIEIGHDAANGQPFISCRRLPSGCIVQDMPNGYSKVTWIEHWEY 490
                     ******************************************************99999999********************************* PP

                     -SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 173 kgrlphwllrslvksglaegaktwvatlqrqcek 206
                     +++++h+l+r+lv sg  +ga +w atlqrqce+
  XP_004496593.1 491 DESVVHQLYRPLVISGFGFGAHRWIATLQRQCEC 524
                     ********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.26E-2081152IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-2182152IPR009057Homeodomain-like
PROSITE profilePS5007117.76792152IPR001356Homeobox domain
SMARTSM003894.3E-1993156IPR001356Homeobox domain
CDDcd000867.21E-1994152No hitNo description
PfamPF000461.7E-1895150IPR001356Homeobox domain
PROSITE patternPS000270127150IPR017970Homeobox, conserved site
PROSITE profilePS5084839.624291527IPR002913START domain
SuperFamilySSF559612.09E-29294524No hitNo description
CDDcd088758.07E-114295523No hitNo description
SMARTSM002344.7E-36300524IPR002913START domain
PfamPF018521.3E-45301524IPR002913START domain
SuperFamilySSF559613.96E-22552784No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 790 aa     Download sequence    Send to blast
MGFESVNSFC RVASVVTDNI YPPIFSSLQN SSSFFSTQRK MEGQSEIGLT GESLDTNNMI  60
GRMREDEYES RSGSDNFEGI SGDDQDAGDE QPKRKKRYHR HTPNQIQELE SFFKECPHPD  120
EKQRLDLSKR LGLENKQVKF WFQNRRTQMK TQLERHENIM LRQENEKLRG ENTMMKEAMS  180
NPVCNNCGGP AIPGQILFEE HQIRIENARL KDELNRICAL TNKFLGKPIS SLASPMALQT  240
SNSGLELGIG RNGMGGSSSL GASLPMGLDL GDSAMPGMRS PMGLMGNSNE IQLERSVLID  300
LALAAMEELL KMAQTDSPIW IKSLDGERDI LNHEEYARLF SSCVGSKPNG FVAEATRESG  360
IVIINSLALM ETLMDANRYA DMFQSMIARA INLDVLSGGI GGTRNGAIHL MHAELQLLSP  420
LVPVRHVRFL RFCKQHAEGV WAVVDVSIEI GHDAANGQPF ISCRRLPSGC IVQDMPNGYS  480
KVTWIEHWEY DESVVHQLYR PLVISGFGFG AHRWIATLQR QCECLAILMS SSISTDDHTA  540
LSQAGRRSML KLAQRMTSNF CSGVCASSAR KWDTLQMGTL SDDMRVMTRK NVDDPGEPPG  600
IVLSAATSVW MPVSRQRLFD FLRDERLRSE WDILSNGGPM QEMVHIAKGQ GQGNCVSLLR  660
ANAVNANDSS MLILQETWMD TSCSVVVYAP VDAQSLNVVM SGGDSAYVAL LPSGFAILPD  720
GNSSDYGASN GTLQKGGSIG SDGGGSLLTV GFQILVNSLP TAKLTMESVD TVNNLISCTI  780
QKIKAALRVA
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004496593.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1494940.0AC149494.4 Medicago truncatula clone mth2-116m7, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004496593.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A1S2XYQ40.0A0A1S2XYQ4_CICAR; homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
STRINGXP_004496593.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]