PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004496523.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family S1Fa-like
Protein Properties Length: 727aa    MW: 79660.5 Da    PI: 6.7775
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004496523.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA253.8e-08306342541
            S1FA   5 kveakGlnPGlivllvvgglllvflvgnyilyvyaqk 41 
                        +kGlnPGli+++ v+  + v l+g  i+yvy +k
  XP_004496523.1 306 SNRSKGLNPGLIIVISVADAVGVALIGLVIVYVYWKK 342
                     5678******************************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF082637.5E-92463IPR013210Leucine-rich repeat-containing N-terminal, plant-type
Gene3DG3DSA:3.80.10.102.9E-5625265IPR032675Leucine-rich repeat domain, L domain-like
SuperFamilySSF520589.07E-4529284IPR032675Leucine-rich repeat domain, L domain-like
PfamPF046892.9E-5308343IPR006779DNA binding protein S1FA
SMARTSM002201.1E-11421725IPR000719Protein kinase domain
PROSITE profilePS5001131.665421725IPR000719Protein kinase domain
PfamPF000696.1E-32426643IPR000719Protein kinase domain
SuperFamilySSF561124.59E-56426722IPR011009Protein kinase-like domain
Gene3DG3DSA:3.30.200.208.4E-13427483No hitNo description
CDDcd140661.54E-84427725No hitNo description
Gene3DG3DSA:1.10.510.101.1E-33484656No hitNo description
PROSITE patternPS001080544556IPR008271Serine/threonine-protein kinase, active site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006468Biological Processprotein phosphorylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0004672Molecular Functionprotein kinase activity
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 727 aa     Download sequence    Send to blast
MTLILLCLFP LCFQLFFNFA LSLSSDGLAL LSLKFAVDQS EDGFFSDWNG GDSNPCGWSG  60
ISCGNISGIP EPRVVGIALA GKSLRGYIPS ELGTLRYLRR LNLHDNEFYG VVPMQLFKAT  120
ALHSIFLHRN NLSGPFPPSA CTVPRLQNLD ISDNFFSGNI PNDIKKCKQL QRLLLARNKF  180
SGEIPSGVWS ELDNLVQLDL SANDFKGSIP DDIGNLVSLS GTLNLSFNHL SDQIPNSLGK  240
LPATVSFDLR NNNLIGEIPQ TGTFSNQGPT AFLGNKDLCG FPLRKSCTGS NRDSGSSSSS  300
HKDEQSNRSK GLNPGLIIVI SVADAVGVAL IGLVIVYVYW KKKDNDNVGS CNRKRRFGDE  360
DEDEDEKGNG CSLLPCISGL NLKNEEDNEN GEVEIDKGGK GEGELVTIDK GLKIELDELL  420
RASTYVLGKS ELGIVYKVVL GNGGPVVVRR LGEGGEERYK EFVAEVQAIG KVKHPNIVRL  480
RAYYWAHDEK LLISDFISNG NLAHALRGRN GQPSSNLSWS TRLRIAKGIA RGLSYLHECS  540
PRKYVHGDIK PSNILLDNDL QPYISDFGLN RLISITGNNP STGGFMGGAL PYMKSSYKEN  600
RTNNNNYKAP EAHVPGCRPT QKWDVYSLGV VMLELLTGKS PESSPMSLSL SSSVSVVEGY  660
ELVRWVRNGF DQQSPLSEMV DPSLLQEVRA KKEVLAVFHV ALACTEGDPE VRPRMKIVFE  720
NLEKIGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4oh4_A1e-4140272519319Protein BRASSINOSTEROID INSENSITIVE 1
4oh4_B1e-4140272519319Protein BRASSINOSTEROID INSENSITIVE 1
4q5j_A1e-4140272519319Protein BRASSINOSTEROID INSENSITIVE 1
4q5j_B1e-4140272519319Protein BRASSINOSTEROID INSENSITIVE 1
5lpb_A7e-424137256294Protein BRASSINOSTEROID INSENSITIVE 1
5lpv_A7e-424137256294Protein BRASSINOSTEROID INSENSITIVE 1
5lpw_A7e-424137256294Protein BRASSINOSTEROID INSENSITIVE 1
5lpy_A7e-424137256294Protein BRASSINOSTEROID INSENSITIVE 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1340355KKKDNDNVGSCNRKRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004496523.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004496523.10.0receptor protein kinase-like protein ZAR1
TrEMBLA0A1S2XYL50.0A0A1S2XYL5_CICAR; receptor protein kinase-like protein ZAR1
STRINGXP_004496523.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF540055
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12020.29e-11WRKY family protein