PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004494878.1
Common NameLHY
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MYB_related
Protein Properties Length: 756aa    MW: 82814.8 Da    PI: 5.9931
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004494878.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding491.4e-152569147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT++E+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
   XP_004494878.1 25 RERWTEDEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 69
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.64E-161975IPR009057Homeodomain-like
PROSITE profilePS5129420.5012074IPR017930Myb domain
TIGRFAMsTIGR015577.1E-172372IPR006447Myb domain, plants
SMARTSM007172.3E-122472IPR001005SANT/Myb domain
PfamPF002498.2E-132568IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-82565IPR009057Homeodomain-like
CDDcd001674.98E-92770No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 756 aa     Download sequence    Send to blast
MMEAYSSGEE VVVKTRKPYT ITKQRERWTE DEHNRFLEAL KLYGRAWQRI EEHIGTKTAV  60
QIRSHAQKFF SKLEKEALVK GAAIGQSLNI DIPPPRPKRK PSNPYPRKTN VGAPTLHSGA  120
KYGKPLTAFA SLHGKEAMDF EKESLPEMHT DDERPTTVKE NNDENCSKVC TILQEAPCLS  180
VSSANKSSIS MSVPQTKSFT FREFIPLVKE VIPQDKTNES FPATETENQM LEIGDGKQTQ  240
KTDGTCKTSK LENTCSPKSV QTEKTDGLTY ASTVDEMQGN QNYPRHITVH VVDGNLGTST  300
QTPSQDMLIQ DSIFQPIGGI NGQPNLFTNS AASNTSESQN NTARSSIHQS FPPCPLFAQH  360
NEDDYQSFLN MPSTFSSLIV STLLQHPAAH AAASFAATFW PYANVDTSAN SHACSQGGFP  420
SRQIGSPPSV TAIAAATVAA ATAWWAAHGL LPLCTPLHTA FACPPASATA VQPANIGEAP  480
PNTEQGDITL QNPSLKDQML GVEETEALQA QHSASKSPAV SSSESEETGD AKLNTSSKAT  540
TDHDISQPIS ENPDSNKMEG RKQVDRSSCG SNTTSSSEET DALEKGEKEK EDPKPPDADH  600
LATDPSSRRY RSISNFIDSW KEVSEEGRLA FRALFSRQVL PQSFSPPHDL INKDHQMGNM  660
TDNMQKTDYK DHLDSTKCSS NCDGFQQNLP FVQNNNEEEG LLTISLGQGK LKTRRTGFKP  720
YKRCLVEAKE NRVGTACNQV EEAGPKRIRL EGETST
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004494878.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ5583780.0KJ558378.1 Cicer arietinum LATE ELONGATED HYPOCOTYL (LHY) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004494878.10.0protein LHY isoform X1
RefseqXP_004494879.10.0protein LHY isoform X1
RefseqXP_004494880.10.0protein LHY isoform X1
RefseqXP_027188030.10.0protein LHY isoform X1
TrEMBLA0A1S2XUV90.0A0A1S2XUV9_CICAR; protein LHY isoform X1
STRINGXP_004494878.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.41e-103MYB_related family protein