PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004494755.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family Whirly
Protein Properties Length: 233aa    MW: 25928.5 Da    PI: 9.6784
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004494755.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly1851.4e-57571911137
          Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalk 95 
                     svyk+kaa+++ + +ptf++ldsg+l+++r+G++++ ++ a++e kydWek+q+falsatev++l+ +++++sceffhdp++k+sn+G+vrk l+
  XP_004494755.1  57 SVYKGKAAFSLSPCLPTFTKLDSGALVVERRGSIMMSFMHAIGEHKYDWEKRQRFALSATEVGSLIAIGPQDSCEFFHDPSMKSSNAGQVRKNLS 151
                     79********************************************************************************************* PP

          Whirly  96 vePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsl 137
                     ++P+++  G+fv+l+v n ++++++sfsvPv+ aefav++++
  XP_004494755.1 152 IKPHSN--GYFVSLNVVNIVLNTKDSFSVPVTTAEFAVMKTA 191
                     ***986..7*******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.103.8E-7244213IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544475.41E-6049213IPR009044ssDNA-binding transcriptional regulator
PfamPF085362.7E-5558190IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MLKLSRALRS YSRHQLLEVV SSTKVEVAGF STATNNYSAK GYNNNYNSSD RIFAPYSVYK  60
GKAAFSLSPC LPTFTKLDSG ALVVERRGSI MMSFMHAIGE HKYDWEKRQR FALSATEVGS  120
LIAIGPQDSC EFFHDPSMKS SNAGQVRKNL SIKPHSNGYF VSLNVVNIVL NTKDSFSVPV  180
TTAEFAVMKT ACSFALPHIM GWDRLTNQQM QSNGTVGFQS KTNPQILDLE WDK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4kop_A2e-83492088169Single-stranded DNA-binding protein WHY2, mitochondrial
4kop_B2e-83492088169Single-stranded DNA-binding protein WHY2, mitochondrial
4kop_C2e-83492088169Single-stranded DNA-binding protein WHY2, mitochondrial
4kop_D2e-83492088169Single-stranded DNA-binding protein WHY2, mitochondrial
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtSingle-stranded DNA-binding protein that associates with mitochondrial DNA and may play a role in the regulation of the gene expression machinery. Seems also to be required to prevent break-induced DNA rearrangements in the mitochondrial genome. Can bind to melt double-stranded DNA in vivo. {ECO:0000269|PubMed:18423020, ECO:0000269|PubMed:20551348, ECO:0000269|PubMed:22762281}.
UniProtSingle-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004494755.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1368330.0BT136833.1 Medicago truncatula clone JCVI-FLMt-6C3 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004494755.11e-176single-stranded DNA-binding protein WHY2, mitochondrial
SwissprotD9J0349e-87WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial
SwissprotQ8VYF79e-87WHY2_ARATH; Single-stranded DNA-binding protein WHY2, mitochondrial
TrEMBLA0A1S2XUK41e-175A0A1S2XUK4_CICAR; single-stranded DNA-binding protein WHY2, mitochondrial
STRINGXP_004494755.11e-176(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF113833338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.14e-89WHIRLY 2