PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004494676.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family GeBP
Protein Properties Length: 427aa    MW: 47664.7 Da    PI: 4.6445
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004494676.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573121.34.9e-38109205197
          DUF573   1 klfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskki 95 
                     klfqrlw++eDe+ lLqG++d+++++g+s ++d+  fy+++k++++++++k+qlveKirrLKkK+++  +k++sgke+sf+++hdq +fe+s+ki
  XP_004494676.1 109 KLFQRLWTDEDEMELLQGFLDYTTQRGSSHHNDTALFYDQIKSKLQLDFNKNQLVEKIRRLKKKYRNVLNKISSGKEFSFKTAHDQATFEISRKI 203
                     579******************************************************************************************** PP

          DUF573  96 Wg 97 
                     W+
  XP_004494676.1 204 WN 205
                     *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045043.5E-34111205IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MASQQHDTVF PEEDIDEDEE GFHEYEEEEE EDDDVLVFDE ENEPSATGSA LAVTVAVPGS  60
SISNGGVRAP ISTPTTTMIV FADSSSSDSK RQRLEPIEEK KPPLEDSRKL FQRLWTDEDE  120
MELLQGFLDY TTQRGSSHHN DTALFYDQIK SKLQLDFNKN QLVEKIRRLK KKYRNVLNKI  180
SSGKEFSFKT AHDQATFEIS RKIWNNVAPI AGEIALDDDE INLNPSPKPN LNFSPVILKS  240
EAISNTRKRS RPRSGIRSFE KRESNDSSIR DRDYINLNHP NPNFIANANF NATTTTNTTT  300
ANTASTTPIT TNATAINANN NNNNCSSSEK NVSGLIEETV RSCLSPLLKE LVSGAMGGPF  360
GTRGGFSMNP FPLQLMNFGF GSGEVLDEKW RKQQILELEV YSKRLELVQD QIKASLDELR  420
SIGGLGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004494676.10.0PREDICTED: dual specificity protein kinase splB-like
TrEMBLG7L0U10.0G7L0U1_MEDTR; DUF573 family protein
STRINGGLYMA19G43180.11e-159(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32553365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.25e-56DNA-binding storekeeper protein-related transcriptional regulator