PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004494351.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family HB-other
Protein Properties Length: 1013aa    MW: 113040 Da    PI: 9.7558
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004494351.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox16.51.4e-0569125157
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                     +r+R  ++++ ++ +++ F  +  +s++e +e+++  g+t +qV+ +F  +R + +k
  XP_004494351.1  69 KRPRDLLNPKAVNYMQSIFSIKDAISKKESREISALFGVTVTQVRDFFTSQRSRVRK 125
                     799**************************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.71866126IPR001356Homeobox domain
SMARTSM003897.8E-468130IPR001356Homeobox domain
SuperFamilySSF466894.02E-669130IPR009057Homeodomain-like
CDDcd000869.67E-469125No hitNo description
Gene3DG3DSA:1.10.10.601.4E-569135IPR009057Homeodomain-like
Gene3DG3DSA:1.20.930.101.4E-4223313IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1013 aa     Download sequence    Send to blast
MEVWNDDLSE LEIGSSVESF QRFLISQREL FHSQIDQFQE IVVTQCKLTG VNPLSQEMAA  60
GALSIKIGKR PRDLLNPKAV NYMQSIFSIK DAISKKESRE ISALFGVTVT QVRDFFTSQR  120
SRVRKLVQLS RERALRSNSC AESHDVQINF DPVRSINPAP LNSAGPINTE EASCSTQEAA  180
LSDLDNLDKQ FVENIFGLMQ QEQTFSGQEK LMEWILTIQN FSVLLWFLTG GGAMTLANWL  240
SKAAVEEQTS ALLLILKVLC HLPLHKALPA HISVLLQSVN RLRFYRTSDI SNRARVLLSK  300
WSKLLTRNQA IKKPNGVKPS GDVQKEIILS QSIGQIIGPE SWHLNIDVPE DILALSNEFS  360
DDFRKMQSRS VKLLLPSSDD CNKKPPLGVS SSQSRERRKV QLVEQPGSVS RSPPVARTVP  420
VSQGRPMSAD DIQKAKMRAL FMQSKYGKTV SSKVNKAKTV SPSKSRTNQA SIAVCSSKVP  480
SPLKIEEDKK PLLLPSKTSI RLESSYSKLK MDLKEPIWEK CKRVKIPWKT PAEVKLQDTW  540
RVGAGENSKE VHVQENRNRR DKESIYQTVQ EMPSNPKEPW DLEMDYDDSL TAEIPIEQLP  600
DGDGAEIVDA SNQTATHAAV QGVASSSSAS NAANAEPDLE LLSVLLKNPE LVFALTSGQA  660
GNITSEETLK LLDMIKRGSV NLGLSENANG NYGTSAKAPE KVEVSLPSPT PSSDPSTSGW  720
SIEAQKNPFT RQNLAPDRRF IQSSASIATT NLSYQIPATS TTVRQQHIVV PSLNQLTGTT  780
VSRYSLPQAT NIIPEKQPPR VHSSVHAQTP FSDRGLSMKN TITAKGPLAM RADGISNIKP  840
VVPNSSMQAG LSNSFPQSFT MTSPSHLATQ QQRHAHTILH QPHFAEPSYQ NPVHSYQPQF  900
EKSGPVSDLR RVRQDIPSSY HDQRNHNNYN TLVGEPMQSG SWDRNNHERE GFESWSPENS  960
PTRNPRYVPG RNIPESRMNH ARNHRPEWSR QRGSSGHWDP GRHENRKWHD QRR
Functional Description ? help Back to Top
Source Description
UniProtSeems to play a role in the regulation of flowering time in the autonomous flowering pathway by repressing FLOWERING LOCUS C expression. {ECO:0000269|PubMed:10363371}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004494351.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY8267320.0AY826732.1 Pisum sativum LUMINIDEPENDENS-like protein mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004494351.10.0homeobox protein LUMINIDEPENDENS
SwissprotQ387961e-162LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A1S2XTK90.0A0A1S2XTK9_CICAR; homeobox protein LUMINIDEPENDENS
STRINGXP_004494350.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-157HB-other family protein
Publications ? help Back to Top
  1. Chakrabortee S, et al.
    Luminidependens (LD) is an Arabidopsis protein with prion behavior.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(21): p. 6065-70
    [PMID:27114519]