PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004493959.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family S1Fa-like
Protein Properties Length: 78aa    MW: 8603.33 Da    PI: 11.0691
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004493959.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA127.73.4e-401478670
            S1FA  6 veakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                    + ++G+nPGlivllvvgglll+fl+gny+ly+yaqk++ PrkkkP+skkk+k+e+l+qGv++PGe
  XP_004493959.1 14 AGSQGFNPGLIVLLVVGGLLLTFLIGNYVLYMYAQKTIAPRKKKPISKKKMKKERLRQGVSAPGE 78
                    5689************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046897.5E-391578IPR006779DNA binding protein S1FA
ProDomPD0190138.0E-51678No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 78 aa     Download sequence    Send to blast
MADKVPPSFD RKNAGSQGFN PGLIVLLVVG GLLLTFLIGN YVLYMYAQKT IAPRKKKPIS  60
KKKMKKERLR QGVSAPGE
Functional Description ? help Back to Top
Source Description
UniProtDNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004493959.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0896975e-57BT089697.1 Soybean clone JCVI-FLGm-2J23 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004493959.18e-50DNA-binding protein S1FA-like
SwissprotQ423372e-15S1FA2_ARATH; DNA-binding protein S1FA2
TrEMBLA0A1S2XU082e-48A0A1S2XU08_CICAR; DNA-binding protein S1FA-like
STRINGXP_004493959.13e-49(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54093355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37120.11e-07S1FA-like DNA-binding protein