PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004493958.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family S1Fa-like
Protein Properties Length: 84aa    MW: 9297 Da    PI: 10.5725
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004493958.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA130.64.3e-411984570
            S1FA  5 kveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                    ++ ++G+nPGlivllvvgglll+fl+gny+ly+yaqk++PPrkkkP+skkk+k+e+l+qGv++PGe
  XP_004493958.1 19 NAGSQGFNPGLIVLLVVGGLLLTFLIGNYALYMYAQKTIPPRKKKPISKKKMKKERLRQGVSAPGE 84
                    56789************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046895.7E-402184IPR006779DNA binding protein S1FA
ProDomPD0190137.0E-42284No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 84 aa     Download sequence    Send to blast
MADDFEFADK VPPSFDRVNA GSQGFNPGLI VLLVVGGLLL TFLIGNYALY MYAQKTIPPR  60
KKKPISKKKM KKERLRQGVS APGE
Functional Description ? help Back to Top
Source Description
UniProtDNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}.
UniProtDNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004493958.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004493958.15e-55DNA-binding protein S1FA-like
SwissprotP425536e-15S1FA1_ORYSJ; DNA-binding protein S1FA1
SwissprotQ7XLX69e-15S1FA2_ORYSJ; DNA-binding protein S1FA2
TrEMBLA0A1S2XSP91e-53A0A1S2XSP9_CICAR; DNA-binding protein S1FA-like
STRINGXP_004493958.12e-54(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54093355
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]