PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004493598.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family HD-ZIP
Protein Properties Length: 290aa    MW: 32451.5 Da    PI: 7.3156
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004493598.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.71.7e-17138192256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++k+q   Le+ F+++ +++ +++  LAk+l+L  rqV vWFqNrRa+ k
  XP_004493598.1 138 RKKLRLSKDQSAFLEDTFKEHTTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 192
                     778899***********************************************98 PP

2HD-ZIP_I/II126.51.1e-40138228192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     +kk+rlsk+q+++LE++F+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  XP_004493598.1 138 RKKLRLSKDQSAFLEDTFKEHTTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCESLTEENRRLQKELQELR-ALK 228
                     69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-17113195IPR009057Homeodomain-like
SuperFamilySSF466893.97E-18128195IPR009057Homeodomain-like
PROSITE profilePS5007116.908134194IPR001356Homeobox domain
SMARTSM003892.0E-15136198IPR001356Homeobox domain
PfamPF000465.5E-15138192IPR001356Homeobox domain
CDDcd000863.07E-15138195No hitNo description
PROSITE patternPS000270169192IPR017970Homeobox, conserved site
CDDcd146860.00839187226No hitNo description
SMARTSM003407.5E-26194237IPR003106Leucine zipper, homeobox-associated
PfamPF021832.9E-11194228IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MELALSLGDT PKPFSLFENP TKLPNKDSCI QLEEAAKSSN QNRGSSDSPI QLDLLPSTPV  60
LRSHPSPLVP IPWLNDALGM EPARVLDNDE GESPNSGVSC FQMEFCMMNG AGRNSSREGG  120
ADRNSTSDDD EEENGSTRKK LRLSKDQSAF LEDTFKEHTT LNPKQKLALA KQLNLRPRQV  180
EVWFQNRRAR TKLKQTEVDC EYLKRCCESL TEENRRLQKE LQELRALKTS KPFYMQLPAT  240
TLTMCPSCER VATNTTGTAL TNNNNASQLS LRKPTIFSLP NGQAHTQQAH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136142TRKKLRL
2186194RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004493598.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004493598.10.0homeobox-leucine zipper protein HOX11
SwissprotP466653e-82HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A1S2XT660.0A0A1S2XT66_CICAR; homeobox-leucine zipper protein HOX11
STRINGXP_004493598.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-69homeobox from Arabidopsis thaliana