PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004492677.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family HD-ZIP
Protein Properties Length: 827aa    MW: 91382.3 Da    PI: 6.7018
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004492677.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.57.1e-21145200156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t++q++eLe++F+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  XP_004492677.1 145 KKRYHRHTPQQIQELESMFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 200
                     688999***********************************************999 PP

2START202.81.5e-633395651206
                     HHHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS.....SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     ela++a++el+k+a+ +ep+W   s     e++n +e+++++++ +     + +ea+r++gvv+ ++  lve+l+d++ +W+e+++    + +t+
  XP_004492677.1 339 ELALAATDELMKMAQNSEPLWINKSfeggrEILNHEEYTKIISTPNCkqngFVYEASRETGVVIINSLALVETLMDSN-RWSEMFPcviaRSSTT 432
                     57999*****************99999**************98766688899**************************.**************** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--...-TTSEE-EESSEEEEEEEECTCEEEEEEEE CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe..sssvvRaellpSgiliepksnghskvtwve 168
                     evis+g      galqlm  elq+lsplvp R++ f+R+++q+ +g+w++vdvS+d  ++ ++  s+++  +++lpSg+++++++ng+skvtwve
  XP_004492677.1 433 EVISNGingtrnGALQLMHGELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDRMRETSSdaSPNFLNCRKLPSGCVVQDMPNGYSKVTWVE 527
                     ************************************************************9999******************************* PP

                     -EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 169 hvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     h+++++r++h+l+r l++sg+ +ga++wvatlqrqce+
  XP_004492677.1 528 HMEYDERQVHELYRGLLRSGMGFGAQRWVATLQRQCEC 565
                     ************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.03E-20129202IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.3E-22135202IPR009057Homeodomain-like
PROSITE profilePS5007117.297142202IPR001356Homeobox domain
SMARTSM003899.5E-18143206IPR001356Homeobox domain
CDDcd000865.52E-18144202No hitNo description
PfamPF000462.1E-18145200IPR001356Homeobox domain
PROSITE patternPS000270177200IPR017970Homeobox, conserved site
PROSITE profilePS5084844.574330568IPR002913START domain
SuperFamilySSF559611.14E-33331565No hitNo description
CDDcd088755.68E-117334564No hitNo description
SMARTSM002345.1E-44339565IPR002913START domain
PfamPF018523.1E-55339565IPR002913START domain
SuperFamilySSF559612.71E-22587808No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 827 aa     Download sequence    Send to blast
MSFSGLILDN KLDSGETESS KIIAEADITY SNGTNHNNNI IRRISSNINT NRIIMPSGAI  60
SQPRLATPTL VKSMYNSSSL SLALKTNIEG EGGDVNRLMA ENTHEANNSL RRNREEEHES  120
RSIGSDNIDG FSGDDFDAAD NPPRKKRYHR HTPQQIQELE SMFKECPHPD EKQRLELSKR  180
LCLETRQVKF WFQNRRTQMK TQLERHENSL LRQAIDKLRA ENMSIREAIR NPMCSNCGGA  240
SIIGEISLEE EHLRIENARL KDELDRVCAL ASKFMNRPIT SLPNSSSVLG SNNGMNDFGI  300
LTSPLGIVSQ NSTRTTTNMV TSSSSNGFDR SMERSMLLEL ALAATDELMK MAQNSEPLWI  360
NKSFEGGREI LNHEEYTKII STPNCKQNGF VYEASRETGV VIINSLALVE TLMDSNRWSE  420
MFPCVIARSS TTEVISNGIN GTRNGALQLM HGELQVLSPL VPVREVNFLR FCKQHAEGVW  480
AVVDVSIDRM RETSSDASPN FLNCRKLPSG CVVQDMPNGY SKVTWVEHME YDERQVHELY  540
RGLLRSGMGF GAQRWVATLQ RQCECLAILM SSTTLPSTQH SAISTGGKRS MLKLAQRMTN  600
NFCAGVCAST VHQWNKLNVG NVGVDVRVMT RKSIDDPGEP PGIVLSAGTS VWLPASPQRV  660
FDFLRDERLR SEWDILSNGG PMQEMAHIAK GHNHGNSVSL LRASANNSSQ SSMLILQETC  720
TDASGSLVVY APVDIPAMHV VMNGGDSAYV ALLPSGFAVL PDGQCQESNN HGGASQQRAS  780
GSLLTVAFQI LVNSLPTAKL TVESVETVNN LISCTVHKIK TALQCET
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004492677.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004492677.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A1S2XR600.0A0A1S2XR60_CICAR; homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
STRINGXP_004492677.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]