PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004491248.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family HB-other
Protein Properties Length: 546aa    MW: 61888.1 Da    PI: 6.9166
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004491248.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.21.2e-172175357
                    --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                    kR   t+ ql+ Le+++ +++yp++e ++e+++ lgLte+qV+ WF+ rR k+k+
  XP_004491248.1 21 KRKLKTPAQLKGLEKFYTEHKYPTEELKKEISEVLGLTEKQVSGWFCHRRLKDKR 75
                    79999************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.3E-19275IPR009057Homeodomain-like
SuperFamilySSF466895.56E-161679IPR009057Homeodomain-like
PROSITE profilePS5007115.921676IPR001356Homeobox domain
SMARTSM003896.1E-171880IPR001356Homeobox domain
CDDcd000863.98E-152176No hitNo description
PfamPF000463.3E-152175IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
MEESSELQPE ENKVSMEKNA KRKLKTPAQL KGLEKFYTEH KYPTEELKKE ISEVLGLTEK  60
QVSGWFCHRR LKDKRMLKDE ANANGRQDRS SGVIQDRGSG LGQDSCGSSK HGDYRYLDPK  120
EVESHGLYNR DLSVGDMTYG RTNHFSENLS GMDDTSSESS SFLQDRLYRQ GQDPYETDPS  180
RYLTPSKALP PINPKGAINA GYKPSGYLKL KGEIEHAAIT AVKKQLGRNY REDGPLLGVE  240
FDPLPPGAFE FQTEDPVHEP YDIADPTLPN SPEISTVKRR PGLNSRYDSY YTKHSSQDTH  300
MEGVDFGSLH DSDVHDKQDK KAYQGTKHRQ NFQSYGTHFP GRNSSLDLYE DSTGEAAYKS  360
TKNHRMETKR GVEGMRSDSA SNHSDHYEEN RAVKNADFLQ YDNDNINPKN MQRSVHADFL  420
QYDYDNIIPK NAQRSEHVKS KPSNSIRNSR VSLDTEERGL STRMAKEEMF KGNKKAKKQY  480
RDAGGAGMLA NETTVAKRLK ANTFQQYNMK QFPAAEIEPR KNQRSAAEMP SSFSEDETAD  540
TSSSMD
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_004491248.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004491248.10.0homeobox-DDT domain protein RLT2
TrEMBLA0A1S2XLR60.0A0A1S2XLR6_CICAR; homeobox-DDT domain protein RLT2
STRINGXP_004491248.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF57923051
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.18e-88HB-other family protein