PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004491008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family LBD
Protein Properties Length: 168aa    MW: 18949.4 Da    PI: 6.6535
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004491008.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601413.7e-4461051100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +Ca+Ck+lrr+C+kdC++apyfp+++p+kfa vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q+++l+ +la
  XP_004491008.1   6 PCASCKLLRRRCTKDCTFAPYFPSHEPQKFALVHKVFGASNVSKMLQELPVQQRADAVSSLVYEANARVRDPVYGCVGAISYLQNQVSELQMQLA 100
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_004491008.1 101 VAQAE 105
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.3325106IPR004883Lateral organ boundaries, LOB
PfamPF031956.1E-446103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MGGNSPCASC KLLRRRCTKD CTFAPYFPSH EPQKFALVHK VFGASNVSKM LQELPVQQRA  60
DAVSSLVYEA NARVRDPVYG CVGAISYLQN QVSELQMQLA VAQAEILCIQ MQQHEQVINP  120
TQEINTDQKS YFLQQDDLTQ YLSYDSSSNV IHDSLKRDNN IYGHNMIS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU3023359e-79CU302335.1 Medicago truncatula chromosome 5 clone mth2-155g22, COMPLETE SEQUENCE.
GenBankCR9541989e-79CR954198.2 Medicago truncatula chromosome 5 clone mte1-67f21, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004491008.11e-124PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW35e-71LBD12_ARATH; LOB domain-containing protein 12
TrEMBLG7K2881e-103G7K288_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGGLYMA18G02780.12e-90(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.13e-72LBD family protein